UniProtKB/Swiss-Prot P13569: Variant p.Val470Met

Cystic fibrosis transmembrane conductance regulator
Gene: CFTR
Feedback?

Variant information Variant position:

470 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Methionine (M) at position 470 (V470M, p.Val470Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs213950 [ dbSNP | Ensembl ]

Sequence information Variant position:

470 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1480 The length of the canonical sequence.
Location on the sequence:

RGQLLAVAGSTGAGKTSLLM V IMGELEPSEGKIKHSGRISF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISF

Gorilla                       RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

                              RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Rhesus macaque                RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Chimpanzee                    RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Mouse                         KGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSF

Rat                           KGEMLAITGSTGAGKTSLLMLILGELEASEGIIKHSGRVSF

Pig                           RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Bovine                        RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Rabbit                        RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Sheep                         RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Horse                         RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISF

Xenopus laevis                KGQLLAIAGSTGAGKTSLLMMIMGELEPSAGKIKHSGRISF

Zebrafish                     KGEMLAVTGSMGSGKSSLLMTILGELVPSSGKIRHSGRISY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1480	Cystic fibrosis transmembrane conductance regulator
Topological domain	359 – 858	Cytoplasmic
Domain	423 – 646	ABC transporter 1
Mutagenesis	464 – 464	K -> M. Impaired maturation of glycan chains indicating impaired trafficking from the endoplasmic reticulum to the cell membrane.
Helix	464 – 471

Literature citations
Identification of the cystic fibrosis gene: cloning and characterization of complementary DNA.
Riordan J.R.; Rommens J.M.; Kerem B.; Alon N.; Rozmahel R.; Grzelczak Z.; Zielenski J.; Lok S.; Plavsic N.; Chou J.-L.; Drumm M.L.; Iannuzzi M.C.; Collins F.S.; Tsui L.-C.;
Science 245:1066-1073(1989)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT MET-470; Genomic DNA sequence of the cystic fibrosis transmembrane conductance regulator (CFTR) gene.
Zielenski J.; Rozmahel R.; Bozon D.; Kerem B.; Grzelczak Z.; Riordan J.R.; Rommens J.; Tsui L.-C.;
Genomics 10:214-228(1991)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT MET-470; Submission
Stacy R.; Subramanian S.; Deodato C.; Burkhardt P.; Song Y.; Paddock M.; Chang J.; Zhou Y.; Haugen E.; Waring D.; Chapman P.; Hayden H.; Levy R.; Wu Z.; Rouse G.; James R.; Phelps K.; Olson M.V.; Kaul R.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS MET-470 AND TRP-1453; Molecular characterization of cystic fibrosis: 16 novel mutations identified by analysis of the whole cystic fibrosis conductance transmembrane regulator (CFTR) coding regions and splice site junctions.
Fanen P.; Ghanem N.; Vidaud M.; Besmond C.; Martin J.; Costes B.; Plassa F.; Goossens M.;
Genomics 13:770-776(1992)
Cited for: VARIANTS VAL-44; MET-470; VAL-506; CYS-508; ALA-576; CYS-668; PHE-997; THR-1027 AND LEU-1162; VARIANTS CF GLY-44; ARG-178; ARG-225; TRP-334; PHE-508 DEL; 542-GLY--LEU-1480 DEL; ASP-551; ILE-562; ARG-628; 710-LYS--LEU-1480 DEL; 846-TRP--LEU-1480 DEL; CYS-913; 1063-TRP--LEU-1480 DEL; CYS-1066; 1092-TYR--LEU-1480 DEL; 1162-ARG--LEU-1480 DEL; GLU-1200; 1282-TRP--LEU-1480 DEL AND LYS-1303; A novel missense mutation D513G in exon 10 of the cystic fibrosis transmembrane conductance regulator (CFTR) gene identified in a French CBAVD patient.
Bienvenu T.; Bousquet S.; Vidaud D.; Hubert D.; Francoual C.; Beldjord C.; Kaplan J.-C.;
Hum. Mutat. 12:213-214(1998)
Cited for: VARIANT CBAVD GLY-513; VARIANT MET-470; Detection of cystic fibrosis transmembrane conductance regulator (CFTR) gene rearrangements enriches the mutation spectrum in congenital bilateral absence of the vas deferens and impacts on genetic counselling.
Ratbi I.; Legendre M.; Niel F.; Martin J.; Soufir J.C.; Izard V.; Costes B.; Costa C.; Goossens M.; Girodon E.;
Hum. Reprod. 22:1285-1291(2007)
Cited for: VARIANTS GLN-75 AND MET-470; VARIANTS CBAVD TRP-74; HIS-110; HIS-117; HIS-170; TRP-206; ASP-232; TRP-334; TYR-443; PHE-508 DEL; VAL-556; ILE-562; ALA-576; ASP-622; CYS-668; GLY-938; ILE-952; VAL-959; PHE-977; PHE-997; CYS-1032; ARG-1069; HIS-1152; GLU-1153; ASN-1270; 1282-TRP--LEU-1480 DEL; HIS-1352 AND 1473-GLU--LEU-1480 DEL; DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
Ley T.J.; Mardis E.R.; Ding L.; Fulton B.; McLellan M.D.; Chen K.; Dooling D.; Dunford-Shore B.H.; McGrath S.; Hickenbotham M.; Cook L.; Abbott R.; Larson D.E.; Koboldt D.C.; Pohl C.; Smith S.; Hawkins A.; Abbott S.; Locke D.; Hillier L.W.; Miner T.; Fulton L.; Magrini V.; Wylie T.; Glasscock J.; Conyers J.; Sander N.; Shi X.; Osborne J.R.; Minx P.; Gordon D.; Chinwalla A.; Zhao Y.; Ries R.E.; Payton J.E.; Westervelt P.; Tomasson M.H.; Watson M.; Baty J.; Ivanovich J.; Heath S.; Shannon W.D.; Nagarajan R.; Walter M.J.; Link D.C.; Graubert T.A.; DiPersio J.F.; Wilson R.K.;
Nature 456:66-72(2008)
Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-470; Clinical hallmarks and genetic polymorphisms in the CFTR gene contribute to the disclosure of the A1006E mutation.
Tomaiuolo A.C.; Alghisi F.; Petrocchi S.; Surace C.; Roberti M.C.; Bella S.; Lucidi V.; Angioni A.;
Clin. Invest. Med. 33:E234-E239(2010)
Cited for: VARIANTS CF 220-GLN--LEU-1480 DEL; MET-470; PHE-508 DEL; ILE-562 AND GLU-1006;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.