Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02730: Variant p.Glu658Lys

Band 3 anion transport protein
Gene: SLC4A1
Feedback?
Variant information Variant position: help 658 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Lysine (K) at position 658 (E658K, p.Glu658Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (E) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help SLC4A1 is responsible for the Diego blood group system [MIM:110500]. The molecular basis of the Di(a)=Di1/Di(b)/Di2 blood group antigens is a single variation in position 854; Leu-854 corresponds to Di(a) and Pro-854 to Di(b). The molecular basis of the Wr(a)=Di3/Wr(b)/Di4 blood group antigens is a single variation in position 658; Lys-658 corresponds to Wr(a) and Glu-658 to Wr(b). The blood group antigens Wd(a)=Di5 (Waldner-type) has Met-557; Rb(a)=Di6 has Leu-548 and WARR=Di7 has Ile-552.SLC4A1 is responsible for the Swann blood group system (SW) [MIM:601550]. Sw(a+) has a Gln or a Trp at position 646 and Sw(a-) has an Arg. - SLC4A1 is responsible for the Froese blood group system (FR) [MIM:601551]. FR(a+) has a Lys at position 480 and FR(a-) has a Glu. - Genetic variations in SLC4A1 are involved in resistance to malaria [MIM:611162]. - Additional information on the polymorphism described.
Variant description: help In WR(a) antigen. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 658 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 911 The length of the canonical sequence.
Location on the sequence: help FKVSNSSARGWVIHPLGLRS E FPIWMMFASALPALLVFILI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         FKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILI

Mouse                         LKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFILI

Rat                           LKVSNSSARGWVIHPLGLYNHFPKWMMFASVLPALLVFILI

Chicken                       LEVTNGTARGWFIHPMGSATPFPIWMMFASPVPALLVFILI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 911 Band 3 anion transport protein
Topological domain 624 – 663 Extracellular
Glycosylation 642 – 642 N-linked (GlcNAc...) (complex) asparagine
Mutagenesis 642 – 642 N -> D. Loss of N-glycosylation site.
Helix 658 – 660



Literature citations
Changes in the blood group Wright antigens are associated with a mutation at amino acid 658 in human erythrocyte band 3: a site of interaction between band 3 and glycophorin A under certain conditions.
Bruce L.J.; Ring S.M.; Anstee D.J.; Reid M.E.; Wilkinson S.; Tanner M.J.;
Blood 85:541-547(1995)
Cited for: VARIANT BLOOD GROUP WR(A) LYS-658;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.