Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P46100: Variant p.Cys200Ser

Transcriptional regulator ATRX
Gene: ATRX
Feedback?
Variant information Variant position: help 200 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Serine (S) at position 200 (C200S, p.Cys200Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ATRX. Any additional useful information about the variant.


Sequence information Variant position: help 200 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2492 The length of the canonical sequence.
Location on the sequence: help HFQKDSIYRHPSLQVLICKN C FKYYMSDDISRDSDGMDEQC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         HFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQC

Chimpanzee                    HFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQC

Mouse                         HFQKDSIYRHPSLKVLICKNCFKYYMSDDISRDSDGMDEQC

Caenorhabditis elegans        ------------------------------SEDSDG-----

Drosophila                    ------------------------------ARHTDA-----

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2492 Transcriptional regulator ATRX
Domain 159 – 296 ADD
Zinc finger 170 – 206 GATA-type; atypical
Modified residue 213 – 213 Phosphoserine
Alternative sequence 1 – 204 Missing. In isoform 1.
Mutagenesis 189 – 189 H -> N. Impairs interaction with histone H3 peptides and reduces localization to pericentromeric heterochromatin foci.
Mutagenesis 203 – 203 Y -> AK. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3); loss of heterochromatic localization.
Mutagenesis 204 – 204 Y -> A. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3) and reduces localization to pericentromeric heterochromatin foci.
Mutagenesis 207 – 207 D -> A. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3) and reduces localization to pericentromeric heterochromatin foci.
Mutagenesis 209 – 209 I -> A. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3).
Mutagenesis 214 – 214 D -> A. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3).
Mutagenesis 217 – 217 D -> A. Impairs interaction with histone H3 peptides trimethylated at 'Lys-10' (H3K9me3); loss of heterochromatic localization.
Mutagenesis 218 – 218 E -> A. Impairs interaction with histone H3 peptides unmethylated at 'Lys-5' (H3K4me0); reduces pericentromeric localization.
Helix 198 – 206



Literature citations
Mutations in transcriptional regulator ATRX establish the functional significance of a PHD-like domain.
Gibbons R.J.; Bachoo S.; Picketts D.J.; Aftimos S.; Asenbauer B.; Bergoffen J.; Berry S.A.; Dahl N.; Fryer A.; Keppler K.; Kurosawa K.; Levin M.L.; Masuno M.; Neri G.; Pierpont M.E.; Slaney S.F.; Higgs D.R.;
Nat. Genet. 17:146-148(1997)
Cited for: VARIANTS ATRX ALA-190; PHE-192; SER-200; ARG-220; SER-222; PHE-243; CYS-246 AND ASP-249;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.