UniProtKB/Swiss-Prot P23786: Variant p.Asp553Asn

Carnitine O-palmitoyltransferase 2, mitochondrial
Gene: CPT2
Chromosomal location: 1p11-p13
Variant information

Variant position:  553
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Aspartate (D) to Asparagine (N) at position 553 (D553N, p.Asp553Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to medium size and polar (N)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Carnitine palmitoyltransferase 2 deficiency late-onset (CPT2D) [MIM:255110]: Autosomal recessive disorder characterized by recurrent myoglobinuria, episodes of muscle pain, stiffness, and rhabdomyolysis. These symptoms are triggered by prolonged exercise, fasting or viral infection and patients are usually young adults. In addition to this classical, late-onset, muscular type, a hepatic or hepatocardiomuscular form has been reported in infants. Clinical pictures in these children or neonates include hypoketotic hypoglycemia, liver dysfunction, cardiomyopathy and sudden death. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CPT2D.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  553
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  658
The length of the canonical sequence.

Location on the sequence:   VECSKYHGQLTKEAAMGQGF  D RHLFALRHLAAAKGIILPEL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPEL

Mouse                         AECSKYHGQLTKEAAMGQGFDRHLFALRYLAAARGVTLPEL

Rat                           AECSKYHGQLTKEAAMGQGFDRHLYALRYLATARGLNLPEL

Bovine                        AKCSTYHNQLTREAAMGQGFDRHLFALRYLAAARGISMPEL

Xenopus laevis                HECSKYHGQLTKEAAMGQGFDRHLFALRHLASSKGLPIPEI

Xenopus tropicalis            QDCSKYHGQLTKEAAMGQGFDRHLFALRYLASSKGLSLPEI

Zebrafish                     NECSKYHGQLTREAAMGQGFDRHLFAMRYLANSKGMALPSL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 26 – 658 Carnitine O-palmitoyltransferase 2, mitochondrial
Topological domain 209 – 658 Mitochondrial matrix
Modified residue 544 – 544 N6-acetyllysine; alternate
Modified residue 544 – 544 N6-succinyllysine; alternate


Literature citations

Carnitine palmitoyltransferase II deficiency: structure of the gene and characterization of two novel disease-causing mutations.
Verderio E.; Cavadini P.; Montermini L.; Wang H.; Lamantea E.; Finocchiaro G.; Didonato S.; Gellera C.; Taroni F.;
Hum. Mol. Genet. 4:19-29(1995)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS CPT2D DEFICIENCY HIS-50 AND ASN-553;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.