UniProtKB/Swiss-Prot P08034: Variant p.Met34Thr

Gap junction beta-1 protein
Gene: GJB1
Feedback?

Variant information Variant position:

34 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Methionine (M) to Threonine (T) at position 34 (M34T, p.Met34Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (M) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In CMTX1; functional channel; localized in the Golgi apparatus without reaching the cell membrane. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs1060500998 [ dbSNP | Ensembl ]

Sequence information Variant position:

34 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

283 The length of the canonical sequence.
Location on the sequence:

NRHSTAIGRVWLSVIFIFRI M VLVVAAESVWGDEKSSFICN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICN

Mouse                         NRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICN

Rat                           NRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICN

Bovine                        NRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICN

Horse                         NRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICN

Xenopus laevis                NRHSTSIGRIWLSVVFIFRIMVLVAAAESVWGDEKSAFTCN

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 283	Gap junction beta-1 protein
Transmembrane	23 – 45	Helical

Literature citations
Novel mutations in the connexin 32 gene associated with X-linked Charcot-Marie tooth disease.
Tan C.C.; Ainsworth P.J.; Hahn A.F.; Macleod P.M.;
Hum. Mutat. 7:167-171(1996)
Cited for: VARIANTS CMTX1 THR-34; GLN-75 AND TRP-107; Charcot-Marie-Tooth disease with intermediate motor nerve conduction velocities: characterization of 14 Cx32 mutations in 35 families.
Rouger H.; Leguern E.; Birouk N.; Gouider R.; Tardieu S.; Plassart E.; Gugenheim M.; Vallat J.-M.; Louboutin J.-P.; Bouche P.; Agid Y.; Brice A.;
Hum. Mutat. 10:443-452(1997)
Cited for: VARIANTS THR-34; ILE-84; MET-95; TRP-107; ARG-133; LEU-141; ALA-158; ASN-203; SER-205 AND 213-ILE-ILE-214 DELINS LEU; Connexin32 and X-linked Charcot-Marie-Tooth disease.
Bone L.J.; Deschenes S.M.; Balice-Gordon R.J.; Fischbeck K.H.; Scherer S.S.;
Neurobiol. Dis. 4:221-230(1997)
Cited for: VARIANTS CMTX1 ARG-3; SER-3; CYS-7; SER-12; LEU-13; MET-13; LYS-14; GLN-15; TRP-15; PRO-16; SER-20; ASP-21; GLN-22; PRO-22; GLY-22; ALA-23; PHE-25; LEU-26; ASN-28; THR-28; LEU-29; ASN-30; THR-34; VAL-34; MET-35; MET-38; VAL-40; LYS-41; LEU-44; TYR-49; SER-53; PHE-56; PHE-60; ILE-63; SER-64; CYS-65; GLN-75; PRO-75; TRP-75; SER-77; ARG-80; CYS-85; PHE-85; ALA-86; ASN-86; SER-86; ALA-87; LEU-87; SER-87; PRO-89; HIS-90; VAL-93; GLN-94; TYR-94; MET-95; TYR-100; GLY-102; GLU-103; TRP-107; 111-HIS--HIS-116 DEL; ASN-124; PRO-128; ARG-133; MET-139; TRP-142; GLU-142; LEU-143 DEL; ARG-156; PHE-156; CYS-157; ALA-158; ARG-158; HIS-160; PRO-161; TRP-164; GLN-164; SER-172; LEU-172; TYR-178; ARG-179; LEU-180; MET-181; THR-182; CYS-183; SER-183; HIS-183; THR-185 DEL; LYS-186; GLU-187; GLY-189; ILE-189; 191-THR--PHE-193 DEL; CYS-193; PHE-198; ARG-199; ARG-201; VAL-204; SER-205; LYS-208; TRP-215; CYS-219; HIS-219; GLY-220; CYS-230; LEU-230; CYS-235 AND HIS-238; Efficient neurophysiologic selection of X-linked Charcot-Marie-Tooth families: ten novel mutations.
Nicholson G.A.; Yeung L.; Corbett A.;
Neurology 51:1412-1416(1998)
Cited for: VARIANTS CMTX1 TRP-9; GLN-22; THR-28; THR-30; THR-34; MET-35; TRP-107; MET-127; PRO-131; ALA-158; THR-182; PHE-192 AND ILE-239; Clinical, electrophysiological and molecular genetic characteristics of 93 patients with X-linked Charcot-Marie-Tooth disease.
Dubourg O.; Tardieu S.; Birouk N.; Gouider R.; Leger J.M.; Maisonobe T.; Brice A.; Bouche P.; LeGuern E.;
Brain 124:1958-1967(2001)
Cited for: VARIANTS CMTX1 GLY-22; THR-34; VAL-34; PHE-56; ILE-84; MET-91; ASP-94; GLN-94; MET-95; TRP-107; ILE-130; ARG-133; LEU-141; GLN-142; ALA-158; ASP-159; TRP-164; GLN-164; LYS-186; ARG-199; ASN-203; SER-205; 213-ILE-ILE-214 DELINS LEU AND TRP-215; CHARACTERIZATION OF VARIANTS CMTX1 GLY-22; THR-34; PHE-56; GLN-94; MET-95; LYS-186 AND TRP-215; Diverse trafficking abnormalities of connexin32 mutants causing CMTX.
Yum S.W.; Kleopa K.A.; Shumas S.; Scherer S.S.;
Neurobiol. Dis. 11:43-52(2002)
Cited for: CHARACTERIZATION OF VARIANTS CMTX ILE-34; LYS-34; THR-34; VAL-34; MET-35; MET-37; MET-38; VAL-40; GLN-75; PRO-75; TRP-75; ILE-205; VAL-213; CYS-219; HIS-219; GLY-220; CYS-230; LEU-230; HIS-238 AND ILE-239;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.