Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P07550: Variant p.Gly16Arg

Beta-2 adrenergic receptor
Gene: ADRB2
Feedback?
Variant information Variant position: help 16 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 16 (G16R, p.Gly16Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help The Gly-16 allele is overrepresented in individuals affected by nocturnal asthma as compared to controls, and appears to be an important genetic factor in the expression of this asthmatic phenotype. Additional information on the polymorphism described.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 16 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 413 The length of the canonical sequence.
Location on the sequence: help MGQPGNGSAFLLAPN G SHAPDHDVTQERDEVWVVGM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGM

                              MGQPANRSVFLLAPNGSHAPDQGDSQERSEAWVVGM

Rhesus macaque                MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGM

Mouse                         MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGM

Rat                           MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGM

Pig                           MGQPGNRSVFLLAPNGSHAPDQDVPQERDEAWVVGM

Bovine                        MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGM

Cat                           MGQPGNRSVFLLAPNGSHAPDQDGTQERNDAWVVGM

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 413 Beta-2 adrenergic receptor
Topological domain 1 – 34 Extracellular
Glycosylation 6 – 6 N-linked (GlcNAc...) asparagine
Glycosylation 15 – 15 N-linked (GlcNAc...) asparagine



Literature citations
Delineation of the intronless nature of the genes for the human and hamster beta 2-adrenergic receptor and their putative promoter regions.
Kobilka B.K.; Frielle T.; Dohlman H.G.; Bolanowski M.A.; Dixon R.A.F.; Keller P.; Caron M.G.; Lefkowitz R.J.;
J. Biol. Chem. 262:7321-7327(1987)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS ARG-16 AND GLN-27; Primary structure of the human beta-adrenergic receptor gene.
Schofield P.R.; Rhee L.M.; Peralta E.G.;
Nucleic Acids Res. 15:3636-3636(1987)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS ARG-16 AND GLN-27; cDNA for the human beta 2-adrenergic receptor: a protein with multiple membrane-spanning domains and encoded by a gene whose chromosomal location is shared with that of the receptor for platelet-derived growth factor.
Kobilka B.K.; Dixon R.A.F.; Frielle T.; Dohlman H.G.; Bolanowski M.A.; Sigal I.S.; Yang-Feng T.L.; Francke U.; Caron M.G.; Lefkowitz R.J.;
Proc. Natl. Acad. Sci. U.S.A. 84:46-50(1987)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS ARG-16 AND GLN-27; Mutations in the gene encoding for the beta 2-adrenergic receptor in normal and asthmatic subjects.
Reihsaus E.; Innis M.; Macintyre N.; Liggett S.B.;
Am. J. Respir. Cell Mol. Biol. 8:334-339(1993)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS ARG-16; GLN-27; MET-34 AND ILE-164; cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org).
Puhl H.L. III; Ikeda S.R.; Aronstam R.S.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANTS ARG-16 AND GLN-27; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANTS ARG-16 AND GLN-27; Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties.
Green S.A.; Turki J.; Innis M.; Ligget S.B.;
Biochemistry 33:9414-9419(1994)
Cited for: VARIANTS ARG-16 AND GLN-27; CHARACTERIZATION; FUNCTION; SUBCELLULAR LOCATION; Genetic polymorphisms of the beta 2-adrenergic receptor in nocturnal and nonnocturnal asthma. Evidence that Gly16 correlates with the nocturnal phenotype.
Turki J.; Pak J.; Green S.A.; Martin R.J.; Liggett S.B.;
J. Clin. Invest. 95:1635-1641(1995)
Cited for: VARIANT ARG-16; POLYMORPHISM;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.