UniProtKB/Swiss-Prot P22607: Variant p.Gly375Cys

Fibroblast growth factor receptor 3
Gene: FGFR3
Chromosomal location: 4p16.3
Variant information

Variant position:  375
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Glycine (G) to Cysteine (C) at position 375 (G375C, p.Gly375Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Achondroplasia (ACH) [MIM:100800]: A frequent form of short-limb dwarfism. It is characterized by a long, narrow trunk, short extremities, particularly in the proximal (rhizomelic) segments, a large head with frontal bossing, hypoplasia of the midface and a trident configuration of the hands. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In ACH.
Any additional useful information about the variant.



Sequence information

Variant position:  375
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  806
The length of the canonical sequence.

Location on the sequence:   VVLPAEEELVEADEAGSVYA  G ILSYGVGFFLFILVVAAVTL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VVL-PAEEELVEAD-EAGSVYAGILSYGVGFFLFILVVAAVTL

Mouse                         VVL-PAEEELMETD-EAGSVYAGVLSYGVVFFLFILVVAAV

Chicken                       TVL-PAEE-LMEMD-DSGSVYAGILSYGTGLVLFILVLVIV

Xenopus laevis                HIYKPAPAEPVEKALTTSSSSITVLIVVTSTIVFILLVIIV

Zebrafish                     TVL-PAVE--MERE-DD---YADILIYVTSCVLFILTMVII

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 23 – 806 Fibroblast growth factor receptor 3
Topological domain 23 – 375 Extracellular
Alternative sequence 311 – 422 Missing. In isoform 3.
Helix 374 – 398


Literature citations

A glycine 375-to-cysteine substitution in the transmembrane domain of the fibroblast growth factor receptor-3 in a newborn with achondroplasia.
Superti-Furga A.; Eich G.; Bucher H.U.; Wisser J.; Giedion A.; Gitzelmann R.; Steinmann B.;
Eur. J. Pediatr. 154:215-219(1995)
Cited for: VARIANT ACH CYS-375;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.