UniProtKB/Swiss-Prot P04275: Variant p.Gly1609Arg

von Willebrand factor
Gene: VWF
Chromosomal location: 12p13.2-p13.3
Variant information

Variant position:  1609
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Glycine (G) to Arginine (R) at position 1609 (G1609R, p.Gly1609Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Von Willebrand disease 2 (VWD2) [MIM:613554]: A hemorrhagic disorder due to defects in von Willebrand factor protein and resulting in altered platelet aggregation. Von Willebrand disease type 2 is characterized by qualitative deficiency and functional anomalies of von Willebrand factor. It is divided in different subtypes including 2A, 2B, 2M and 2N (Normandy variant). The mutant VWF protein in types 2A, 2B and 2M are defective in their platelet-dependent function, whereas the mutant protein in type 2N is defective in its ability to bind factor VIII. Clinical manifestations are mucocutaneous bleeding, such as epistaxis and menorrhagia, and prolonged bleeding after surgery or trauma. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In VWD2.
Any additional useful information about the variant.



Sequence information

Variant position:  1609
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2813
The length of the canonical sequence.

Location on the sequence:   SFLVSQGDREQAPNLVYMVT  G NPASDEIKRLPGDIQVVPIG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SFLVSQGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIG

Mouse                         SFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIG

Dog                           SFSVSQGDREQVPNLVYMVTGNPASDEIKRMPGDIQVVPIG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 764 – 2813 von Willebrand factor
Domain 1498 – 1665 VWFA 2


Literature citations

Identification of three candidate mutations causing type IIA von Willebrand disease using a rapid, nonradioactive, allele-specific hybridization method.
Inbal A.; Englender T.; Kornbrot N.; Randi A.M.; Castaman G.; Mannucci P.M.; Sadler J.E.;
Blood 82:830-836(1993)
Cited for: VARIANTS VWD2 GLN-1597; ARG-1609 AND GLU-1665;

Two new candidate mutations in type IIA von Willebrand's disease (Arg834-->Gly, Gly846-->Arg) and one polymorphism (Tyr821-->Cys) in the A2 region of the von Willebrand factor.
Donner M.; Kristoffersson A.C.; Berntorp E.; Scheibel E.; Thorsen S.; Dahlback B.; Nilsson I.M.; Holmberg L.;
Eur. J. Haematol. 51:38-44(1993)
Cited for: VARIANTS VWD2 GLY-1597 AND ARG-1609; VARIANT CYS-1584;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.