Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P49768: Variant p.Pro436Gln

Presenilin-1
Gene: PSEN1
Feedback?
Variant information Variant position: help 436 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Glutamine (Q) at position 436 (P436Q, p.Pro436Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In AD3; severe decrease of protease activity with APP. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 436 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 467 The length of the canonical sequence.
Location on the sequence: help IGLCLTLLLLAIFKKALPAL P ISITFGLVFYFATDYLVQPF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 299 – 467 Presenilin-1 CTF subunit
Chain 346 – 467 Presenilin-1 CTF12
Transmembrane 433 – 453 Helical
Region 322 – 450 Required for interaction with CTNNB1
Alternative sequence 185 – 467 Missing. In isoform 4.
Alternative sequence 319 – 467 STERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI -> RACLPPAAINLLSIAPMAPRLFMPKGACRPTAQKGSHKTLLQRMMMAGSVRNGKPRGTVI. In isoform 3 and isoform 5.
Mutagenesis 420 – 420 L -> R. Decreased protease activity with APP. Increased amyloid-beta 42/amyloid-beta 40 ratio in vitro.
Mutagenesis 424 – 424 L -> V. Increases protease activity with APP.
Mutagenesis 432 – 432 L -> P. Loss of NOTCH1 and APP C83 cleavage.
Mutagenesis 433 – 433 P -> A. No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing. Slightly increased amyloid-beta protein 42/40 ratio.
Mutagenesis 433 – 433 P -> DFLNV. No endoproteolytic cleavage; no APP, nor NOTCH1 processing. No detectable amyloid-beta.
Mutagenesis 433 – 433 P -> G. Very little endoproteolysis. Little APP processing. No NOTCH1 processing. Very low levels amyloid-beta protein 40 and no detectable amyloid-beta protein 42.
Mutagenesis 434 – 434 A -> C. Some loss of endoproteolytic cleavage. Some loss of APP and NOTCH1 processing. 6 to 13-fold increase in amyloid-beta protein 42/40 ratio.
Mutagenesis 434 – 434 A -> DILV. No endoproteolytic cleavage. No APP nor NOTCH1 processing. No detectable amyloid-beta.
Mutagenesis 434 – 434 A -> G. No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing. Reduced amyloid-beta protein 42/40 ratio.
Mutagenesis 435 – 435 L -> A. No effect on endoproteolytic cleavage. No effect on APP processing. Impaired NOTCH1 processing. Greatly reduced amyloid-beta protein 42/40 ratio.
Mutagenesis 435 – 435 L -> G. Greatly reduced endoproteolytic cleavage. Very little APP and NOTCH1 processing. Very low levels of amyloid-beta protein 40 and no detectable amyloid-beta protein 42.
Mutagenesis 435 – 435 L -> I. No effect on endoproteolytic cleavage. No effect on APP nor NOTCH1 processing.
Mutagenesis 435 – 435 L -> R. No endoproteolytic cleavage; no APP, nor NOTCH1 processing. No detectable amyloid-beta.
Mutagenesis 435 – 435 L -> V. No effect on endoproteolytic cleavage. No effect on APP processing. Impaired NOTCH1 processing. Some increase in amyloid-beta protein 42/40 ratio.
Mutagenesis 437 – 437 I -> V. Decreased protease activity with APP. Increased amyloid-beta 42/amyloid-beta 40 ratio in vitro.



Literature citations
Two novel presenilin-1 mutations (Ser169Leu and Pro436Gln) associated with very early onset Alzheimer's disease.
Taddei K.; Kwok J.B.; Kril J.J.; Halliday G.M.; Creasey H.; Hallupp M.; Fisher C.; Brooks W.S.; Chung C.; Andrews C.; Masters C.L.; Schofield P.R.; Martins R.N.;
NeuroReport 9:3335-3339(1998)
Cited for: VARIANTS AD3 LEU-169 AND GLN-436; A presenilin-1 mutation identified in familial Alzheimer disease with cotton wool plaques causes a nearly complete loss of gamma-secretase activity.
Heilig E.A.; Xia W.; Shen J.; Kelleher R.J. III;
J. Biol. Chem. 285:22350-22359(2010)
Cited for: VARIANT AD3 PHE-435; CHARACTERIZATION OF VARIANTS AD3 PHE-435; GLN-436 AND SER-436; MUTAGENESIS OF PRO-433 AND LEU-435; FUNCTION; Alzheimer's disease-linked mutations in presenilin-1 result in a drastic loss of activity in purified gamma-secretase complexes.
Cacquevel M.; Aeschbach L.; Houacine J.; Fraering P.C.;
PLoS ONE 7:E35133-E35133(2012)
Cited for: CHARACTERIZATION OF VARIANTS AD3 PRO-166 AND GLN-436; MUTAGENESIS OF ASP-257 AND ASP-385;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.