UniProtKB/Swiss-Prot O15118: Variant p.Ile1061Thr

Niemann-Pick C1 protein
Gene: NPC1
Chromosomal location: 18q11-q12
Variant information

Variant position:  1061
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Isoleucine (I) to Threonine (T) at position 1061 (I1061T, p.Ile1061Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (I) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In NPC1; late infantile form.
Any additional useful information about the variant.



Sequence information

Variant position:  1061
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1278
The length of the canonical sequence.

Location on the sequence:   YHTVLQTSADFIDALKKARL  I ASNVTETMGINGSAYRVFPY
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YHTVLQ--TSADFIDALKKARLIASNVTETMGINGSAYRVFPY

Mouse                         YHTILK--TSADYTDAMKKARLIASNITETMRSKGSDYRVF

Pig                           YHTVLQ--ASADFIDAMQKARLIASNITRTMGLEASSYRVF

Caenorhabditis elegans        FHKKLSISNSSDFIKAMDTARMVSRRLERSIDDT---AHVF

Baker's yeast                 AHHPLR--SQKDFIQAYSDGVRISSSFPE--------LDMF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 23 – 1278 Niemann-Pick C1 protein
Topological domain 854 – 1098 Lumenal
Glycosylation 1064 – 1064 N-linked (GlcNAc...)
Glycosylation 1072 – 1072 N-linked (GlcNAc...)


Literature citations

NPC1: complete genomic sequence, mutation analysis, and characterization of haplotypes.
Bauer P.; Knoblich R.; Bauer C.; Finckh U.; Hufen A.; Kropp J.; Braun S.; Kustermann-Kuhn B.; Schmidt D.; Harzer K.; Rolfs A.;
Hum. Mutat. 19:30-38(2002)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS NPC1 ARG-512; TRP-670; CYS-825; ILE-849; VAL-874; TYR-948; LEU-954; LEU-958; ALA-1007 AND THR-1061; VARIANTS ARG-215; ILE-642; VAL-858; GLY-971 AND VAL-1049;

Mutations in NPC1 highlight a conserved NPC1-specific cysteine-rich domain.
Greer W.L.; Dobson M.J.; Girouard G.S.; Byers D.M.; Riddell D.C.; Neumann P.E.;
Am. J. Hum. Genet. 65:1252-1260(1999)
Cited for: VARIANTS NPC1 GLN-934; LEU-940; ASN-948; LEU-954; TRP-992; ALA-1007; THR-1061 AND VAL-1213;

Niemann-Pick C1 disease: the I1061T substitution is a frequent mutant allele in patients of Western European descent and correlates with a classic juvenile phenotype.
Millat G.; Marcais C.; Rafi M.A.; Yamamoto T.; Morris J.A.; Pentchev P.G.; Ohno K.; Wenger D.A.; Vanier M.T.;
Am. J. Hum. Genet. 65:1321-1329(1999)
Cited for: VARIANT NPC1 THR-1061;

Genotype-phenotype relationship of Niemann-Pick disease type C: a possible correlation between clinical onset and levels of NPC1 protein in isolated skin fibroblasts.
Yamamoto T.; Ninomiya H.; Matsumoto M.; Ohta Y.; Nanba E.; Tsutsumi Y.; Yamakawa K.; Millat G.; Vanier M.T.; Pentchev P.G.; Ohno K.;
J. Med. Genet. 37:707-712(2000)
Cited for: VARIANTS NPC1 GLY-177; SER-237; PRO-473; PRO-510; GLN-518; SER-703; MET-889; LEU-954; TYR-956; ARG-996; THR-1061; CYS-1088; ARG-1205; PHE-1213 AND GLU-1236; VARIANT ALA-873;

Niemann-Pick C variant detection by altered sphingolipid trafficking and correlation with mutations within a specific domain of NPC1.
Sun X.; Marks D.L.; Park W.D.; Wheatley C.L.; Puri V.; O'Brien J.F.; Kraft D.L.; Lundquist P.A.; Patterson M.C.; Pagano R.E.; Snow K.;
Am. J. Hum. Genet. 68:1361-1372(2001)
Cited for: VARIANTS NPC1 ARG-92; MET-137; SER-237; ASN-242; VAL-248; THR-401; GLN-404; ASP-612; TRP-652; CYS-789; CYS-825; VAL-874; SER-888; PRO-929; LEU-940; ASN-944; ASN-948; GLN-958; ARG-976; CYS-978; LEU-1004; ALA-1007; GLY-1023; THR-1061; LYS-1089; THR-1142; LYS-1150; SER-1156; MET-1165; HIS-1186 AND GLY-1189;

Niemann-Pick C1 disease: correlations between NPC1 mutations, levels of NPC1 protein, and phenotypes emphasize the functional significance of the putative sterol-sensing domain and of the cysteine-rich luminal loop.
Millat G.; Marcais C.; Tomasetto C.; Chikh K.; Fensom A.H.; Harzer K.; Wenger D.A.; Ohno K.; Vanier M.T.;
Am. J. Hum. Genet. 68:1373-1385(2001)
Cited for: VARIANTS NPC1 SER-237; HIS-242; ARG-272; ALA-378; GLN-404; GLN-518; VAL-605; ARG-631; PRO-724; PRO-775; CYS-825; VAL-874; GLN-934; MET-943; ASN-944; MET-950; SER-986; ARG-992; ALA-1007; THR-1054; THR-1061; THR-1142; TYR-1168 AND HIS-1186;

Niemann-Pick type C disease: NPC1 mutations associated with severe and mild cellular cholesterol trafficking alterations.
Ribeiro I.; Marcao A.; Amaral O.; Sa Miranda M.C.; Vanier M.T.; Millat G.;
Hum. Genet. 109:24-32(2001)
Cited for: VARIANTS NPC1 ARG-92; TYR-177; TRP-518; CYS-942; CYS-978; ALA-1007 VAL-1035 AND THR-1061; VARIANTS ARG-215; ILE-642 AND VAL-858;

Niemann-Pick type C disease: mutations of NPC1 gene and evidence of abnormal expression of some mutant alleles in fibroblasts.
Tarugi P.; Ballarini G.; Bembi B.; Battisti C.; Palmeri S.; Panzani F.; Di Leo E.; Martini C.; Federico A.; Calandra S.;
J. Lipid Res. 43:1908-1919(2002)
Cited for: VARIANTS NPC1 LYS-451; LEU-474; CYS-890; ASP-899; SER-910; TRP-992; ALA-1007; THR-1061 AND SER-1156; VARIANTS ARG-215; ILE-642 AND VAL-858;

Identification of 25 new mutations in 40 unrelated Spanish Niemann-Pick type C patients: genotype-phenotype correlations.
Fernandez-Valero E.M.; Ballart A.; Iturriaga C.; Lluch M.; Macias J.; Vanier M.T.; Pineda M.; Coll M.J.;
Clin. Genet. 68:245-254(2005)
Cited for: VARIANTS NPC1 MET-137; TYR-177; TRP-372; LEU-434; LEU-474; TYR-479; ARG-576; MET-664; PHE-727; LYS-754; PRO-775; LEU-865; THR-926; CYS-942; ASN-944; HIS-948; GLU-959; 961-ASN--PHE-966 DELINS SER; ALA-1007; VAL-1035; LYS-1036; THR-1061; ASN-1066; ILE-1156; SER-1156 AND LEU-1224; VARIANTS ARG-215; ILE-642; VAL-858 AND GLN-1266;

Niemann-Pick C disease: use of denaturing high performance liquid chromatography for the detection of NPC1 and NPC2 genetic variations and impact on management of patients and families.
Millat G.; Baielo N.; Molinero S.; Rodriguez C.; Chikh K.; Vanier M.T.;
Mol. Genet. Metab. 86:220-232(2005)
Cited for: VARIANTS NPC1 SER-166; TYR-177; PRO-404; LEU-537; LEU-543; LEU-615; ARG-631; LEU-763; CYS-825; LEU-862; LEU-865; CYS-871; TYR-917; GLN-934; LEU-940; MET-950; SER-968; ALA-992; ARG-992; TRP-992; ALA-1007; MET-1036; THR-1061; VAL-1062; ASN-1097; VAL-1174; HIS-1186; VAL-1216 AND ARG-1240; VARIANT MET-511;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.