Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q14524: Variant p.His558Arg

Sodium channel protein type 5 subunit alpha
Gene: SCN5A
Feedback?
Variant information Variant position: help 558 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Histidine (H) to Arginine (R) at position 558 (H558R, p.His558Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (H) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Channels properties are similar to wild-type; the double mutant R-558/I-512 channel shows that R-558 eliminates the negative shift induced by Ile-512 but only partially restores the kinetic abnormalities; can modulate the gating defects caused by Ala-2006 and other mutations. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 558 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2016 The length of the canonical sequence.
Location on the sequence: help GSEADFADDENSTAGESESH H TSLLVPWPLRRTSAQGQPSP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSP

Mouse                         GSEADFADDENSTAGESESHRTSLLVPWPLRRPSTQGQPGF

Rat                           GSEADFADDENSTAGESESHRTSLLVPWPLRHPSAQGQPGP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2016 Sodium channel protein type 5 subunit alpha
Topological domain 411 – 717 Cytoplasmic
Region 461 – 591 Disordered
Modified residue 539 – 539 Phosphoserine
Modified residue 571 – 571 Phosphoserine



Literature citations
A ubiquitous splice variant and a common polymorphism affect heterologous expression of recombinant human SCN5A heart sodium channels.
Makielski J.C.; Ye B.; Valdivia C.R.; Pagel M.D.; Pu J.; Tester D.J.; Ackerman M.J.;
Circ. Res. 93:821-828(2003)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2); VARIANTS ARG-558 AND TYR-1103; A common human SCN5A polymorphism modifies expression of an arrhythmia causing mutation.
Ye B.; Valdivia C.R.; Ackerman M.J.; Makielski J.C.;
Physiol. Genomics 12:187-193(2003)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2); VARIANT ARG-558; CHARACTERIZATION OF VARIANT LQT3 LEU-1766; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3); VARIANT ARG-558; Allelic variants in long-QT disease genes in patients with drug-associated torsades de pointes.
Yang P.; Kanki H.; Drolet B.; Yang T.; Wei J.; Viswanathan P.C.; Hohnloser S.H.; Shimizu W.; Schwartz P.J.; Stanton M.; Murray K.T.; Norris K.; George A.L. Jr.; Roden D.M.;
Circulation 105:1943-1948(2002)
Cited for: VARIANTS LQT3 GLU-615; PHE-619 AND LEU-1250; VARIANTS CYS-34 AND ARG-558; Novel mutations in domain I of SCN5A cause Brugada syndrome.
Vatta M.; Dumaine R.; Antzelevitch C.; Brugada R.; Li H.; Bowles N.E.; Nademanee K.; Brugada J.; Brugada P.; Towbin J.A.;
Mol. Genet. Metab. 75:317-324(2002)
Cited for: VARIANTS BRGDA1 GLU-126 AND VAL-351; CHARACTERIZATION OF VARIANT BRGDA1 VAL-351; VARIANT ARG-558; A common SCN5A polymorphism modulates the biophysical effects of an SCN5A mutation.
Viswanathan P.C.; Benson D.W.; Balser J.R.;
J. Clin. Invest. 111:341-346(2003)
Cited for: VARIANT PFHB1A ILE-512; CHARACTERIZATION OF VARIANT PFHB1A ILE-512; VARIANT ARG-558; CHARACTERIZATION OF VARIANT ARG-558; Cardiac sodium channel (SCN5A) variants associated with atrial fibrillation.
Darbar D.; Kannankeril P.J.; Donahue B.S.; Kucera G.; Stubblefield T.; Haines J.L.; George A.L. Jr.; Roden D.M.;
Circulation 117:1927-1935(2008)
Cited for: VARIANTS ATFB10 ILE-138; LEU-216; HIS-376; LYS-428; ASP-445; LYS-470; ASP-572; LYS-655; LYS-1053; ILE-1131; CYS-1826 AND MET-1951; VARIANTS CYS-34; VAL-461; TRP-481; TYR-524; ARG-558; PHE-618; SER-997 AND TYR-1103; VARIANTS LQT3 GLN-1193; LEU-1951 AND LEU-2004; SCN5A variants in Japanese patients with left ventricular noncompaction and arrhythmia.
Shan L.; Makita N.; Xing Y.; Watanabe S.; Futatani T.; Ye F.; Saito K.; Ibuki K.; Watanabe K.; Hirono K.; Uese K.; Ichida F.; Miyawaki T.; Origasa H.; Bowles N.E.; Towbin J.A.;
Mol. Genet. Metab. 93:468-474(2008)
Cited for: VARIANTS ARG-558 AND LEU-1090; An international compendium of mutations in the SCN5A-encoded cardiac sodium channel in patients referred for Brugada syndrome genetic testing.
Kapplinger J.D.; Tester D.J.; Alders M.; Benito B.; Berthet M.; Brugada J.; Brugada P.; Fressart V.; Guerchicoff A.; Harris-Kerr C.; Kamakura S.; Kyndt F.; Koopmann T.T.; Miyamoto Y.; Pfeiffer R.; Pollevick G.D.; Probst V.; Zumhagen S.; Vatta M.; Towbin J.A.; Shimizu W.; Schulze-Bahr E.; Antzelevitch C.; Salisbury B.A.; Guicheney P.; Wilde A.A.; Brugada R.; Schott J.J.; Ackerman M.J.;
Heart Rhythm 7:33-46(2010)
Cited for: VARIANTS TRP-18; CYS-34; HIS-34; SER-286; SER-291; MET-299; CYS-376; GLY-447; ALA-449; VAL-461; SER-475; TRP-481; TYR-524; ARG-558; HIS-568; ARG-579; LYS-592; GLY-596; ALA-601; PHE-618; ASP-638; LEU-656; THR-672; HIS-689; LYS-692; PHE-705; ILE-924; GLN-986; MET-1016; ARG-1040; ALA-1082; LEU-1090; LEU-1098; TYR-1103; LYS-1107; TRP-1116; GLN-1193; MET-1251; SER-1293; PHE-1308; TRP-1512; ASN-1787; THR-1836; LYS-1901; CYS-1919; LEU-1951; GLN-1958; LEU-1962; MET-1968; GLN-1991; LEU-2004 AND ALA-2006; VARIANTS BRGDA1 GLN-18; LYS-70; ASN-84; SER-93; SER-94; GLN-104; TRP-104; LYS-109; GLN-121; TRP-121; GLU-126; PRO-136; MET-146; GLN-161; LYS-161; ASN-175; GLY-178; ARG-182; VAL-185; VAL-204; GLN-212; LEU-216; ILE-220; GLN-222; LEU-223; TRP-225; VAL-226; ILE-232; MET-240; LYS-270; GLN-276; ASP-278; CYS-282; ILE-300; PRO-315; ASN-320; ARG-325; LEU-336; ASP-351; VAL-351; ASN-356; CYS-367; HIS-367; LEU-367; LYS-369; GLY-374; HIS-376; ARG-386; GLU-386; ALA-396; LEU-396; LYS-439; GLY-501; HIS-526; CYS-532; LEU-543; ARG-552; GLU-615; PHE-619; CYS-620; MET-632; ALA-640; ASP-647; LEU-648; TRP-661; GLY-683; LEU-701; LEU-717; VAL-735; LYS-746; ARG-752; GLU-758; ARG-764; ASN-772; SER-773; ILE-789; PRO-808; PRO-839; LEU-851; GLN-867; CYS-878; HIS-878; PRO-886; CYS-893; HIS-893; LYS-901; LEU-910; ARG-915; ARG-917; SER-927; PRO-928; PRO-935; CYS-965; HIS-965; THR-997; LYS-1053; GLY-1055; TYR-1079; VAL-1113; THR-1140; ASN-1219; LYS-1225; HIS-1228; GLN-1232; TRP-1232; PRO-1239; ASN-1243; ASP-1249; GLY-1253; SER-1262; CYS-1271; ASN-1275; GLY-1288; PRO-1311; VAL-1319; GLY-1323; LEU-1332; LEU-1344; ILE-1346; PRO-1346; ARG-1351; MET-1353; TRP-1358; ASN-1359; CYS-1360; TYR-1363; ILE-1382; LEU-1405; MET-1405; ARG-1406; GLU-1406; ARG-1408; CYS-1409; PHE-1412; GLU-1419; ARG-1420; SER-1427; VAL-1428; GLY-1432; SER-1432; VAL-1433; LEU-1438; GLN-1441; LEU-1448; THR-1448; CYS-1449; ASP-1451; TYR-1463; PHE-1468; VAL-1501; LYS-1521; MET-1525; LYS-1548; CYS-1571; LYS-1574; PRO-1582; CYS-1583; HIS-1583; MET-1604; LEU-1613; MET-1620; GLN-1623; GLN-1629; GLU-1642; VAL-1660; ARG-1661; ILE-1667; TYR-1672; THR-1680; THR-1698; ARG-1709; MET-1709; SER-1712; GLY-1714; ASP-1722; ARG-1728; TRP-1728; ARG-1740; ARG-1743; GLU-1743; PHE-1764; MET-1779; LYS-1784; GLU-1832; ILE-1861; ASN-1872; LEU-1903; THR-1924; SER-1935; LYS-1938 AND VAL-2004; A common SCN5A polymorphism modulates the biophysical defects of SCN5A mutations.
Shinlapawittayatorn K.; Du X.X.; Liu H.; Ficker E.; Kaufman E.S.; Deschenes I.;
Heart Rhythm 8:455-462(2011)
Cited for: CHARACTERIZATION OF VARIANTS ARG-558 AND ALA-2006; p.D1690N Nav1.5 rescues p.G1748D mutation gating defects in a compound heterozygous Brugada syndrome patient.
Nunez L.; Barana A.; Amoros I.; de la Fuente M.G.; Dolz-Gaiton P.; Gomez R.; Rodriguez-Garcia I.; Mosquera I.; Monserrat L.; Delpon E.; Caballero R.; Castro-Beiras A.; Tamargo J.;
Heart Rhythm 10:264-272(2013)
Cited for: VARIANT ARG-558; VARIANTS BRGDA1 ASN-1690 AND ASP-1748; CHARACTERIZATION OF VARIANTS BRGDA1 ASN-1690 AND ASP-1748; FUNCTION; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.