Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q15465: Variant p.Asn115Lys

Sonic hedgehog protein
Gene: SHH
Feedback?
Variant information Variant position: help 115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Lysine (K) at position 115 (N115K, p.Asn115Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In HPE3; familial; in the mouse sequence shows no change in activities at different temperatures. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 462 The length of the canonical sequence.
Location on the sequence: help DRLMTQRCKDKLNALAISVM N QWPGVKLRVTEGWDEDGHHS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHS

Mouse                         DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHS

Rat                           DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHS

Chicken                       DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHS

Xenopus laevis                DRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHL

Zebrafish                     DRLMTQRCKDKLNSLAISVMNHWPGVKLRVTEGWDEDGHHF

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 24 – 462 Sonic hedgehog protein
Chain 24 – 197 Sonic hedgehog protein N-product
Binding site 95 – 95
Binding site 125 – 125
Binding site 126 – 126
Binding site 126 – 126
Binding site 129 – 129
Binding site 131 – 131
Mutagenesis 111 – 115 ISVMN -> ESVMK. Abolished binding to PTCH1.
Helix 100 – 116



Literature citations
The mutational spectrum of the sonic hedgehog gene in holoprosencephaly: SHH mutations cause a significant proportion of autosomal dominant holoprosencephaly.
Nanni L.; Ming J.E.; Bocian M.; Steinhaus K.; Bianchi D.W.; Die-Smulders C.; Giannotti A.; Imaizumi K.; Jones K.L.; Campo M.D.; Martin R.A.; Meinecke P.; Pierpont M.E.M.; Robin N.H.; Young I.D.; Roessler E.; Muenke M.;
Hum. Mol. Genet. 8:2479-2488(1999)
Cited for: VARIANTS HPE3 VAL-88; LYS-115; ARG-236; 263-ARG--ALA-269 DEL; ASP-290; ALA-424 AND LEU-436;
Molecular mechanisms of Sonic hedgehog mutant effects in holoprosencephaly.
Maity T.; Fuse N.; Beachy P.A.;
Proc. Natl. Acad. Sci. U.S.A. 102:17026-17031(2005)
Cited for: CHARACTERIZATION OF VARIANTS HPE3 ARG-31; VAL-88; HIS-100; LYS-115; ARG-117; GLY-117 AND GLN-188;
The mutational spectrum of holoprosencephaly-associated changes within the SHH gene in humans predicts loss-of-function through either key structural alterations of the ligand or its altered synthesis.
Roessler E.; El-Jaick K.B.; Dubourg C.; Velez J.I.; Solomon B.D.; Pineda-Alvarez D.E.; Lacbawan F.; Zhou N.; Ouspenskaia M.; Paulussen A.; Smeets H.J.; Hehr U.; Bendavid C.; Bale S.; Odent S.; David V.; Muenke M.;
Hum. Mutat. 30:E921-E935(2009)
Cited for: VARIANTS HPE3 THR-6; PRO-17; LEU-26; ALA-27; ARG-31; PRO-39; LYS-53; VAL-83; PHE-84; VAL-88; HIS-100; ARG-102; TYR-102; 106-LEU-ASN-107 DEL; PHE-109; THR-110; ASP-110; PHE-111; ASN-111; LYS-115; GLY-117; ARG-117; MET-124; LYS-136; PRO-140; GLN-140; ASP-143; PRO-144; ASN-147; ARG-150; LYS-150; ARG-156; CYS-170; HIS-171; 176-GLU--LYS-178 DEL; ARG-183; PHE-183; TYR-183; LEU-184; GLN-188; GLU-196; 196-GLY--PRO-200 DEL; VAL-197; SER-198; PHE-198; PRO-218; ASN-222; GLU-224; THR-226; VAL-231; GLY-232; PRO-234; ARG-236; ASN-236; VAL-241; LEU-241; ASN-255; 263-ARG--ALA-269 DEL; ILE-267; PRO-271; GLU-275; TRP-280; ASP-290; ALA-296; CYS-310; SER-321; ALA-332; VAL-346; ARG-347; GLN-347; LEU-347; THR-354; LEU-362; TYR-363; CYS-364; THR-373; ARG-374; ASP-376; SER-377; 378-ALA--PHE-380 DEL; PRO-381; PRO-382; THR-383; THR-391; 402-GLY--GLY-409 DEL; 405-ASP--GLY-409 DEL; GLY-411 INS; ALA-416; ALA-424; ASN-435; LEU-436 AND ARG-456;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.