Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02533: Variant p.Ile377Asn

Keratin, type I cytoskeletal 14
Gene: KRT14
Feedback?
Variant information Variant position: help 377 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Isoleucine (I) to Asparagine (N) at position 377 (I377N, p.Ile377Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In EBS1C. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 377 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 472 The length of the canonical sequence.
Location on the sequence: help NSLEETKGRYCMQLAQIQEM I GSVEEQLAQLRCEMEQQNQE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         NSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQE

Mouse                         NNLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQE

Rat                           NNLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQE

Chicken                       GTLADTEARYGTQLAQLQALITSVEEQLAELRCDMERQNHE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 472 Keratin, type I cytoskeletal 14
Domain 115 – 426 IF rod
Region 284 – 422 Coil 2
Site 364 – 364 Stutter
Disulfide bond 367 – 367 Interchain
Mutagenesis 365 – 365 R -> A. No effect on interaction with KRT5 or keratin intermediate filament networks.
Mutagenesis 366 – 366 Y -> A. No effect on interaction with KRT5 or keratin intermediate filament networks.
Mutagenesis 367 – 367 C -> A. Loss of SFN-YAP proximity.
Mutagenesis 372 – 372 Q -> A. No effect on interaction with KRT5 or keratin intermediate filament networks.
Helix 329 – 417



Literature citations
Keratin 14 gene mutations in patients with epidermolysis bullosa simplex.
Chen H.; Bonifas J.M.; Matsumura K.; Ikeda S.; Leyden W.A.; Epstein E.H. Jr.;
J. Invest. Dermatol. 105:629-632(1995)
Cited for: VARIANTS EBS1C ILE-119; ASP-274; ASN-377 AND CYS-388; VARIANTS EBS1A ARG-120; CYS-125 AND SER-125;
Mutations in KRT5 and KRT14 cause epidermolysis bullosa simplex in 75% of the patients.
Bolling M.C.; Lemmink H.H.; Jansen G.H.; Jonkman M.F.;
Br. J. Dermatol. 164:637-644(2011)
Cited for: VARIANTS EBS1C ASN-377; THR-377; CYS-388; MET-408; GLU-411 DEL AND PHE-412; VARIANTS EBS1A SER-123; CYS-125; PRO-130; ARG-272 AND GLN-419;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.