UniProtKB/Swiss-Prot Q06609: Variant p.Arg150Gln

DNA repair protein RAD51 homolog 1
Gene: RAD51
Chromosomal location: 15q15.1
Variant information

Variant position:  150
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Arginine (R) to Glutamine (Q) at position 150 (R150Q, p.Arg150Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Breast cancer (BC) [MIM:114480]: A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In BC; familial.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  150
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  339
The length of the canonical sequence.

Location on the sequence:   RTGKTQICHTLAVTCQLPID  R GGGEGKAMYIDTEGTFRPER
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Mouse                         RTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Bovine                        RTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Rabbit                        RTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Dog                           RTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Chicken                       RTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER

Drosophila                    RCGKTQLCHTLAVTCQLPISQKGGEGKCMYIDTENTFRPER

Baker's yeast                 RTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVR

Fission yeast                 RTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 339 DNA repair protein RAD51 homolog 1
Alternative sequence 77 – 173 Missing. In isoform 2.
Helix 148 – 150


Literature citations

Identification of Rad51 alteration in patients with bilateral breast cancer.
Kato M.; Yano K.; Matsuo F.; Saito H.; Katagiri T.; Kurumizaka H.; Yoshimoto M.; Kasumi F.; Akiyama F.; Sakamoto G.; Nagawa H.; Nakamura Y.; Miki Y.;
J. Hum. Genet. 45:133-137(2000)
Cited for: VARIANT BC GLN-150;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.