UniProtKB/Swiss-Prot O76024: Variant p.Ala684Val

Wolframin
Gene: WFS1
Chromosomal location: 4p16.1
Variant information

Variant position:  684
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Alanine (A) to Valine (V) at position 684 (A684V, p.Ala684Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and hydrophobic (V)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Wolfram-like syndrome autosomal dominant (WFSL) [MIM:614296]: A disease characterized by the clinical triad of congenital progressive hearing impairment, diabetes mellitus, and optic atrophy. The hearing impairment, which is usually diagnosed in the first decade of life, is relatively constant and alters mainly low- and middle-frequency ranges. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In WFSL; greatly reduces protein expression compared to wild-type.
Any additional useful information about the variant.



Sequence information

Variant position:  684
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  890
The length of the canonical sequence.

Location on the sequence:   LTWQQYGALCGPRAWKETNM  A RTQILCSHLEGHRVTWTGRF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRF

Mouse                         LTWQQYGFLCGPRAWKETNMARTQILCSHLEGHRVTWTGRF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 890 Wolframin
Topological domain 653 – 869 Lumenal


Literature citations

Identification of novel WFS1 mutations in Italian children with Wolfram syndrome.
Tessa A.; Carbone I.; Matteoli M.C.; Bruno C.; Patrono C.; Patera I.P.; De Luca F.; Lorini R.; Santorelli F.M.;
Hum. Mutat. 17:348-349(2001)
Cited for: VARIANT WFS1 ILE-443; VARIANTS ILE-333; HIS-611; VAL-684 AND CYS-708;

Identification of p.A684V missense mutation in the WFS1 gene as a frequent cause of autosomal dominant optic atrophy and hearing impairment.
Rendtorff N.D.; Lodahl M.; Boulahbel H.; Johansen I.R.; Pandya A.; Welch K.O.; Norris V.W.; Arnos K.S.; Bitner-Glindzicz M.; Emery S.B.; Mets M.B.; Fagerheim T.; Eriksson K.; Hansen L.; Bruhn H.; Moller C.; Lindholm S.; Ensgaard S.; Lesperance M.M.; Tranebjaerg L.;
Am. J. Med. Genet. A 155:1298-1313(2011)
Cited for: VARIANTS WFSL VAL-684; SER-780 AND TYR-797; VARIANT WFS1 VAL-415 DEL; CHARACTERIZATION OF VARIANTS WFSL VAL-684 AND SER-780; CHARACTERIZATION OF VARIANT WFS1 VAL-415 DEL;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.