Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q92736: Variant p.Asn4104Lys

Ryanodine receptor 2
Gene: RYR2
Feedback?
Variant information Variant position: help 4104 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Lysine (K) at position 4104 (N4104K, p.Asn4104Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CPVT1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 4104 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 4967 The length of the canonical sequence.
Location on the sequence: help VKRFHEPAKDIGFNVAVLLT N LSEHMPNDTRLQTFLELAES The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         VKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAES

Mouse                         VKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAES

Rat                           VKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAES

Rabbit                        VKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAES

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 4967 Ryanodine receptor 2
Topological domain 1 – 4281 Cytoplasmic
Mutagenesis 4108 – 4108 H -> N. Changed ryanodine-sensitive calcium-release channel activity characterized by increased sensitivity to cytosolic calcium activation.
Mutagenesis 4108 – 4108 H -> Q. Changed ryanodine-sensitive calcium-release channel activity characterized by increased sensitivity to cytosolic calcium activation.
Mutagenesis 4112 – 4112 D -> N. Decreased function in release of sequestered calcium ion into cytosol by sarcoplasmic reticulum. Changed ryanodine-sensitive calcium-release channel activity. Mutant channels are less respositive to activation by caffeine and store calcium overload. Affects channel sensitivity to cytosolic and luminal calcium activation.
Helix 4080 – 4108



Literature citations
Mutations in the cardiac ryanodine receptor gene (hRyR2) underlie catecholaminergic polymorphic ventricular tachycardia.
Priori S.G.; Napolitano C.; Tiso N.; Memmi M.; Vignati G.; Bloise R.; Sorrentino V.V.; Danieli G.A.;
Circulation 103:196-200(2001)
Cited for: VARIANTS CPVT1 LEU-2246; SER-2474; LYS-4104 AND CYS-4497;
Clinical and molecular characterization of patients with catecholaminergic polymorphic ventricular tachycardia.
Priori S.G.; Napolitano C.; Memmi M.; Colombi B.; Drago F.; Gasparini M.; DeSimone L.; Coltorti F.; Bloise R.; Keegan R.; Cruz Filho F.E.S.; Vignati G.; Benatar A.; DeLogu A.;
Circulation 106:69-74(2002)
Cited for: VARIANTS CPVT1 LEU-2246; ASP-2311; SER-2474; PHE-3778; SER-3946; SER-3946; LYS-4104; CYS-4497; ILE-4771; MET-4867; ASP-4895 AND LYS-4950; VARIANT VACRDS GLY-4860;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.