UniProtKB/Swiss-Prot Q9UGJ0: Variant p.His383Arg

5'-AMP-activated protein kinase subunit gamma-2
Gene: PRKAG2
Chromosomal location: 7q36
Variant information

Variant position:  383
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Histidine (H) to Arginine (R) at position 383 (H383R, p.His383Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cardiomyopathy, familial hypertrophic 6 (CMH6) [MIM:600858]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. CMH6 patients present Wolff-Parkinson-White ventricular preexcitation, enlarged myocytes without myofiber disarray, and glycogen-containing cytosolic vacuoles within cardiomyocytes. {ECO:0000269|PubMed:11371514, ECO:0000269|PubMed:11827995}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CMH6; severe; impaired AMP- and ATP-binding.
Any additional useful information about the variant.



Sequence information

Variant position:  383
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  569
The length of the canonical sequence.

Location on the sequence:   NISPDASLFDAVYSLIKNKI  H RLPVIDPISGNALYILTHKR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKR

Mouse                         NISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 569 5'-AMP-activated protein kinase subunit gamma-2
Domain 357 – 415 CBS 2
Motif 370 – 391 AMPK pseudosubstrate
Binding site 383 – 383 AMP 2
Binding site 383 – 383 AMP 3
Binding site 383 – 383 ATP 2
Binding site 384 – 384 ATP 1
Binding site 384 – 384 ATP 2
Binding site 402 – 402 AMP 1
Binding site 402 – 402 ATP 1
Mutagenesis 387 – 387 V -> S. Induces phosphorylation by AMPK.


Literature citations

CBS domains form energy-sensing modules whose binding of adenosine ligands is disrupted by disease mutations.
Scott J.W.; Hawley S.A.; Green K.A.; Anis M.; Stewart G.; Scullion G.A.; Norman D.G.; Hardie D.G.;
J. Clin. Invest. 113:274-284(2004)
Cited for: DOMAIN CBS; AMP-BINDING; ATP-BINDING; CHARACTERIZATION OF VARIANTS WPWS GLN-302; ARG-383 AND ASN-400; CHARACTERIZATION OF VARIANT WPWS GLY-531; FUNCTION;

Mutations in the gamma(2) subunit of AMP-activated protein kinase cause familial hypertrophic cardiomyopathy: evidence for the central role of energy compromise in disease pathogenesis.
Blair E.; Redwood C.; Ashrafian H.; Oliveira M.; Broxholme J.; Kerr B.; Salmon A.; Oestman-Smith I.; Watkins H.;
Hum. Mol. Genet. 10:1215-1220(2001)
Cited for: VARIANTS CMH6 LEU-350 INS AND ARG-383;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.