Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P19224: Variant p.Arg184Ser

UDP-glucuronosyltransferase 1-6
Gene: UGT1A6
Feedback?
Variant information Variant position: help 184 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Serine (S) at position 184 (R184S, p.Arg184Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Polymorphisms in the UGT1A6 gene define four common haplotypes: UGT1A6*1, UGT1A6*2, UGT1A6*3 and UGT1A6*4. Liver tissue samples that were homozygous for UGT1A6*2 exhibited a high rate of glucuronidation relative to tissues with other genotypes. Biochemical kinetic studies indicate that the UGT1A6*2 allozyme, expressed homozygously, had almost two-fold greater activity toward p-nitrophenol than UGT1A6*1 and when expressed heterozygously (UGT1A6*1/*2) it is associated with low enzyme activity. Common genetic variation in UGT1A6 confers functionally significant differences in biochemical phenotype. This genetic variation might impact clinical efficacy or toxicity of drugs metabolized by UGT1A6. Additional information on the polymorphism described.
Variant description: help In allele UGT1A6*2 and allele UGT1A6*4. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 184 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 532 The length of the canonical sequence.
Location on the sequence: help GLPSVYLFRGFPCSLEHTFS R SPDPVSYIPRCYTKFSDHMT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMT

Mouse                         NLPSVYLFRGFPCSLEHMLGQSPSPVSYVPRFYTKFSDHMT

Rat                           KLPSIYLFRGFPCSLEH-IGQSPSPVSYVPRFYTKFSDHMT

Rabbit                        GLPSVYLFRGFPCSLEHGFGGSPNPVSYIPRCYTKFSDQMS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 27 – 532 UDP-glucuronosyltransferase 1-6
Alternative sequence 1 – 267 Missing. In isoform 2.



Literature citations
Submission
Guillemette C.; Levesque E.; Girard H.; Bernard O.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3); VARIANTS ALA-181 AND SER-184; Genetic polymorphism in the human UGT1A6 (planar phenol) UDP-glucuronosyltransferase: pharmacological implications.
Ciotti M.; Marrone A.; Potter C.; Owens I.S.;
Pharmacogenetics 7:485-495(1997)
Cited for: VARIANTS ALA-181 AND SER-184; Human UGT1A6 pharmacogenetics: identification of a novel SNP, characterization of allele frequencies and functional analysis of recombinant allozymes in human liver tissue and in cultured cells.
Nagar S.; Zalatoris J.J.; Blanchard R.L.;
Pharmacogenetics 14:487-499(2004)
Cited for: VARIANTS ALA-7; ALA-181 AND SER-184; Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
Menard V.; Girard H.; Harvey M.; Perusse L.; Guillemette C.;
Hum. Mutat. 30:677-687(2009)
Cited for: VARIANTS ALA-181 AND SER-184;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.