UniProtKB/Swiss-Prot O15528: Variant p.Val478Gly

25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
Gene: CYP27B1
Chromosomal location: 12q13.3-q14
Variant information

Variant position:  478
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Valine (V) to Glycine (G) at position 478 (V478G, p.Val478Gly).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (V) to glycine (G)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Rickets vitamin D-dependent 1A (VDDR1A) [MIM:264700]: A disorder caused by a selective deficiency of the active form of vitamin D (1,25-dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In VDDR1A.
Any additional useful information about the variant.



Sequence information

Variant position:  478
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  508
The length of the canonical sequence.

Location on the sequence:   RRLAELELQMALAQILTHFE  V QPEPGAAPVRPKTRTVLVPE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RRLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLVPE

Mouse                         RRLAELELQMALSQILTHFEVLPEPGALPIKPMTRTVLVPE

Rat                           RRLAELELQMALAQILTHFEVLPEPGALPVKPMTRTVLVPE



Literature citations

Novel mutations in the 1alpha-hydroxylase (P450c1) gene in three families with pseudovitamin D-deficiency rickets resulting in loss of functional enzyme activity in blood-derived macrophages.
Smith S.J.; Rucka A.K.; Berry J.L.; Davies M.; Mylchreest S.; Paterson C.R.; Heath D.A.; Tassabehji M.; Read A.P.; Mee A.P.; Mawer E.B.;
J. Bone Miner. Res. 14:730-739(1999)
Cited for: VARIANTS VDDR1A TYR-323 AND GLY-478;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.