UniProtKB/Swiss-Prot P35222: Variant p.Ser33Phe

Catenin beta-1
Gene: CTNNB1
Feedback?

Variant information Variant position:

33 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Phenylalanine (F) at position 33 (S33F, p.Ser33Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and polar (S) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In PTR, MDB and hepatocellular carcinoma. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs121913400 [ dbSNP | Ensembl ]

Sequence information Variant position:

33 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

781 The length of the canonical sequence.
Location on the sequence:

AMEPDRKAAVSHWQQQSYLD S GIHSGATTTAPSLSGKGNPE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

                              AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Mouse                         AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Rat                           AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Bovine                        AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Xenopus laevis                AMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Zebrafish                     AMDPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPE

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 781	Catenin beta-1
Modified residue	23 – 23	Phosphoserine; by GSK3-beta; alternate
Modified residue	29 – 29	Phosphoserine; by GSK3-beta
Modified residue	33 – 33	Phosphoserine; by GSK3-beta and HIPK2
Modified residue	37 – 37	Phosphoserine; by GSK3-beta and HIPK2
Modified residue	41 – 41	Phosphothreonine; by GSK3-beta
Modified residue	45 – 45	Phosphoserine
Modified residue	49 – 49	N6-acetyllysine
Glycosylation	23 – 23	O-linked (GlcNAc) serine; alternate
Mutagenesis	29 – 29	S -> F. No effect.

Literature citations
A common human skin tumour is caused by activating mutations in beta-catenin.
Chan E.F.; Gat U.; McNiff J.M.; Fuchs E.;
Nat. Genet. 21:410-413(1999)
Cited for: VARIANTS PTR GLY-32; TYR-32; PHE-33; TYR-33; GLU-34; CYS-37; PHE-37 AND ILE-41; Beta-catenin mutations in hepatocellular carcinoma correlate with a low rate of loss of heterozygosity.
Legoix P.; Bluteau O.; Bayer J.; Perret C.; Balabaud C.; Belghiti J.; Franco D.; Thomas G.; Laurent-Puig P.; Zucman-Rossi J.;
Oncogene 18:4044-4046(1999)
Cited for: VARIANTS HEPATOCELLULAR CARCINOMA ARG-23; 25-TRP--SER-33 DEL; ALA-32; GLY-32; TYR-32; LEU-33; PHE-33; ARG-34; SER-35; ALA-37; 37-SER-GLY-38 DELINS TRP; TYR-37; ALA-41; ILE-41; PHE-45 AND PRO-45; APC mutations in sporadic medulloblastomas.
Huang H.; Mahler-Araujo B.M.; Sankila A.; Chimelli L.; Yonekawa Y.; Kleihues P.; Ohgaki H.;
Am. J. Pathol. 156:433-437(2000)
Cited for: VARIANTS MDB PHE-33 AND ALA-37;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.