Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35222: Variant p.Gly34Glu

Catenin beta-1
Gene: CTNNB1
Feedback?
Variant information Variant position: help 34 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Glutamate (E) at position 34 (G34E, p.Gly34Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PTR. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 34 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 781 The length of the canonical sequence.
Location on the sequence: help MEPDRKAAVSHWQQQSYLDS G IHSGATTTAPSLSGKGNPEE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEE

                              MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEE

Mouse                         MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEE

Rat                           MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEE

Bovine                        MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEE

Xenopus laevis                MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPED

Zebrafish                     MDPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPED
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 781 Catenin beta-1
Region 34 – 57 Disordered
Compositional bias 34 – 48 Polar residues
Modified residue 23 – 23 Phosphoserine; by GSK3-beta; alternate
Modified residue 29 – 29 Phosphoserine; by GSK3-beta
Modified residue 33 – 33 Phosphoserine; by GSK3-beta and HIPK2
Modified residue 37 – 37 Phosphoserine; by GSK3-beta and HIPK2
Modified residue 41 – 41 Phosphothreonine; by GSK3-beta
Modified residue 45 – 45 Phosphoserine
Modified residue 49 – 49 N6-acetyllysine
Glycosylation 23 – 23 O-linked (GlcNAc) serine; alternate
Mutagenesis 29 – 29 S -> F. No effect.



Literature citations
A common human skin tumour is caused by activating mutations in beta-catenin.
Chan E.F.; Gat U.; McNiff J.M.; Fuchs E.;
Nat. Genet. 21:410-413(1999)
Cited for: VARIANTS PTR GLY-32; TYR-32; PHE-33; TYR-33; GLU-34; CYS-37; PHE-37 AND ILE-41;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.