UniProtKB/Swiss-Prot Q14524: Variant p.Thr1620Met

Sodium channel protein type 5 subunit alpha
Gene: SCN5A
Feedback?

Variant information Variant position:

1620 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Methionine (M) at position 1620 (T1620M, p.Thr1620Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In BRGDA1; arrhythmogenicity revealed only at temperatures approaching the physiologic range. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs199473282 [ dbSNP | Ensembl ]

Sequence information Variant position:

1620 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2016 The length of the canonical sequence.
Location on the sequence:

ILSIVGTVLSDIIQKYFFSP T LFRVIRLARIGRILRLIRGA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGA

Mouse                         ILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGA

Rat                           ILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGA

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2016	Sodium channel protein type 5 subunit alpha
Topological domain	1608 – 1620	Extracellular
Repeat	1510 – 1807	IV
Mutagenesis	1610 – 1610	D -> A. Complete loss of channel inhibition by the spider Jingzhaotoxin-I.
Mutagenesis	1610 – 1610	D -> R. High decrease in affinity to the sea anemone toxin anthopleurin-B.
Mutagenesis	1614 – 1614	K -> A. 4.2-fold decrease of channel inhibition potency by the spider Jingzhaotoxin-I.

Literature citations
Genetic basis and molecular mechanism for idiopathic ventricular fibrillation.
Chen Q.; Kirsch G.E.; Zhang D.; Brugada R.; Brugada J.; Brugada P.; Potenza D.; Moya A.; Borggrefe M.; Breithardt G.; Ortiz-Lopez R.; Wang Z.; Antzelevitch C.; O'Brien R.E.; Schulze-Bahr E.; Keating M.T.; Towbin J.A.; Wang Q.;
Nature 392:293-296(1998)
Cited for: VARIANTS BRGDA1 TRP-1232 AND MET-1620; Ionic mechanisms responsible for the electrocardiographic phenotype of the Brugada syndrome are temperature dependent.
Dumaine R.; Towbin J.A.; Brugada P.; Vatta M.; Nesterenko D.V.; Nesterenko V.V.; Brugada J.; Brugada R.; Antzelevitch C.;
Circ. Res. 85:803-809(1999)
Cited for: CHARACTERIZATION OF VARIANT BRGDA1 MET-1620; Cardiac Na(+) channel dysfunction in Brugada syndrome is aggravated by beta(1)-subunit.
Makita N.; Shirai N.; Wang D.W.; Sasaki K.; George A.L. Jr.; Kanno M.; Kitabatake A.;
Circulation 101:54-60(2000)
Cited for: CHARACTERIZATION OF VARIANT BRGDA1 MET-1620; An international compendium of mutations in the SCN5A-encoded cardiac sodium channel in patients referred for Brugada syndrome genetic testing.
Kapplinger J.D.; Tester D.J.; Alders M.; Benito B.; Berthet M.; Brugada J.; Brugada P.; Fressart V.; Guerchicoff A.; Harris-Kerr C.; Kamakura S.; Kyndt F.; Koopmann T.T.; Miyamoto Y.; Pfeiffer R.; Pollevick G.D.; Probst V.; Zumhagen S.; Vatta M.; Towbin J.A.; Shimizu W.; Schulze-Bahr E.; Antzelevitch C.; Salisbury B.A.; Guicheney P.; Wilde A.A.; Brugada R.; Schott J.J.; Ackerman M.J.;
Heart Rhythm 7:33-46(2010)
Cited for: VARIANTS TRP-18; CYS-34; HIS-34; SER-286; SER-291; MET-299; CYS-376; GLY-447; ALA-449; VAL-461; SER-475; TRP-481; TYR-524; ARG-558; HIS-568; ARG-579; LYS-592; GLY-596; ALA-601; PHE-618; ASP-638; LEU-656; THR-672; HIS-689; LYS-692; PHE-705; ILE-924; GLN-986; MET-1016; ARG-1040; ALA-1082; LEU-1090; LEU-1098; TYR-1103; LYS-1107; TRP-1116; GLN-1193; MET-1251; SER-1293; PHE-1308; TRP-1512; ASN-1787; THR-1836; LYS-1901; CYS-1919; LEU-1951; GLN-1958; LEU-1962; MET-1968; GLN-1991; LEU-2004 AND ALA-2006; VARIANTS BRGDA1 GLN-18; LYS-70; ASN-84; SER-93; SER-94; GLN-104; TRP-104; LYS-109; GLN-121; TRP-121; GLU-126; PRO-136; MET-146; GLN-161; LYS-161; ASN-175; GLY-178; ARG-182; VAL-185; VAL-204; GLN-212; LEU-216; ILE-220; GLN-222; LEU-223; TRP-225; VAL-226; ILE-232; MET-240; LYS-270; GLN-276; ASP-278; CYS-282; ILE-300; PRO-315; ASN-320; ARG-325; LEU-336; ASP-351; VAL-351; ASN-356; CYS-367; HIS-367; LEU-367; LYS-369; GLY-374; HIS-376; ARG-386; GLU-386; ALA-396; LEU-396; LYS-439; GLY-501; HIS-526; CYS-532; LEU-543; ARG-552; GLU-615; PHE-619; CYS-620; MET-632; ALA-640; ASP-647; LEU-648; TRP-661; GLY-683; LEU-701; LEU-717; VAL-735; LYS-746; ARG-752; GLU-758; ARG-764; ASN-772; SER-773; ILE-789; PRO-808; PRO-839; LEU-851; GLN-867; CYS-878; HIS-878; PRO-886; CYS-893; HIS-893; LYS-901; LEU-910; ARG-915; ARG-917; SER-927; PRO-928; PRO-935; CYS-965; HIS-965; THR-997; LYS-1053; GLY-1055; TYR-1079; VAL-1113; THR-1140; ASN-1219; LYS-1225; HIS-1228; GLN-1232; TRP-1232; PRO-1239; ASN-1243; ASP-1249; GLY-1253; SER-1262; CYS-1271; ASN-1275; GLY-1288; PRO-1311; VAL-1319; GLY-1323; LEU-1332; LEU-1344; ILE-1346; PRO-1346; ARG-1351; MET-1353; TRP-1358; ASN-1359; CYS-1360; TYR-1363; ILE-1382; LEU-1405; MET-1405; ARG-1406; GLU-1406; ARG-1408; CYS-1409; PHE-1412; GLU-1419; ARG-1420; SER-1427; VAL-1428; GLY-1432; SER-1432; VAL-1433; LEU-1438; GLN-1441; LEU-1448; THR-1448; CYS-1449; ASP-1451; TYR-1463; PHE-1468; VAL-1501; LYS-1521; MET-1525; LYS-1548; CYS-1571; LYS-1574; PRO-1582; CYS-1583; HIS-1583; MET-1604; LEU-1613; MET-1620; GLN-1623; GLN-1629; GLU-1642; VAL-1660; ARG-1661; ILE-1667; TYR-1672; THR-1680; THR-1698; ARG-1709; MET-1709; SER-1712; GLY-1714; ASP-1722; ARG-1728; TRP-1728; ARG-1740; ARG-1743; GLU-1743; PHE-1764; MET-1779; LYS-1784; GLU-1832; ILE-1861; ASN-1872; LEU-1903; THR-1924; SER-1935; LYS-1938 AND VAL-2004;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.