Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9N2K0: Variant p.Phe150Leu

HERV-H_2q24.3 provirus ancestral Env polyprotein
Gene: null
Feedback?
Variant information Variant position: help 150 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Phenylalanine (F) to Leucine (L) at position 150 (F150L, p.Phe150Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Envelope protein HERV-H19 and HERV-H/p62 are allelic variants of the same provirus. Additional information on the polymorphism described.
Variant description: help In allele HERV-H19. Any additional useful information about the variant.


Sequence information Variant position: help 150 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 584 The length of the canonical sequence.
Location on the sequence: help ALLRTYLKNLSPYINSTPPI F GPLTTQTTIPVAAPLCISWQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ALLRTYLKNLSPYINSTPPIFGPLTTQTTIPVAAPLCISWQ

Chimpanzee                    ALLHTYLKHLSPYINSTPPIFGPLTTQTTIPVAAPLCISRR

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 36 – 584 HERV-H_2q24.3 provirus ancestral Env polyprotein
Chain 36 – 387 Surface protein
Topological domain 36 – 523 Extracellular



Literature citations
Isolation of a human endogenous retroviral HERV-H element with an open env reading frame.
Lindeskog M.; Mager D.L.; Blomberg J.;
Virology 258:441-450(1999)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS LEU-81 AND LEU-150;
Characterization of the three HERV-H proviruses with an open envelope reading frame encompassing the immunosuppressive domain and evolutionary history in primates.
de Parseval N.; Casella J.-F.; Gressin L.; Heidmann T.;
Virology 279:558-569(2001)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS LEU-81 AND LEU-150;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.