UniProtKB/Swiss-Prot P23560: Variant p.Thr2Ile

Brain-derived neurotrophic factor
Gene: BDNF
Chromosomal location: 11p13
Variant information

Variant position:  2
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Threonine (T) to Isoleucine (I) at position 2 (T2I, p.Thr2Ile).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (I)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Congenital central hypoventilation syndrome (CCHS) [MIM:209880]: Rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. {ECO:0000269|PubMed:11840487}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CCHS.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.

Sequence information

Variant position:  2
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  247
The length of the canonical sequence.

Location on the sequence:   M  T ILFLTMVISYFGCMKAAPMK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MTILFLTMVISYFGCMKAAPMK

Chimpanzee                    MTILFLTMVISYFGCMKAAPMK

Mouse                         MTILFLTMVISYFGCMKAAPMK

Rat                           MTILFLTMVISYFGCMKAAPMK

Pig                           MTILFLTMVISYFGCMKAAPMK

Bovine                        MTILFLTMVISYFGCMKAAPMK

Cat                           MTILFLTMVISYFGCMKAAPMK

Dog                           MTILFLTMVISYFGCMKAAPMK

Horse                         MTILFLTMVISYFGCMKAAPMK

Chicken                       MTILFLTMVISYFSCMKAAPMK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

Signal peptide 1 – 18
Alternative sequence 1 – 1 M -> MFHQVRRVM. In isoform 2.
Alternative sequence 1 – 1 M -> MQSREEEWFHQVRRVM. In isoform 3.
Alternative sequence 1 – 1 M -> MLCAISLCARVRKLRSAGRCGKFHQVRRVM. In isoform 5.

Literature citations

Idiopathic congenital central hypoventilation syndrome: evaluation of brain-derived neurotrophic factor genomic DNA sequence variation.
Weese-Mayer D.E.; Bolk S.; Silvestri J.M.; Chakravarti A.;
Am. J. Med. Genet. 107:306-310(2002)
Cited for: VARIANT CCHS ILE-2;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.