UniProtKB/Swiss-Prot P35579: Variant p.Lys373Asn

Myosin-9
Gene: MYH9
Chromosomal location: 22q13.1
Variant information

Variant position:  373
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Lysine (K) to Asparagine (N) at position 373 (K373N, p.Lys373Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (K) to medium size and polar (N)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  May-Hegglin anomaly (MHA) [MIM:155100]: A disorder characterized by thrombocytopenia, giant platelets and Dohle body-like inclusions in peripheral blood leukocytes. Appearing as highly parallel paracrystalline bodies. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Involvement in disease:  Sebastian syndrome (SBS) [MIM:605249]: Autosomal dominant macrothrombocytopenia characterized by thrombocytopenia, giant platelets and leukocyte inclusions that are smaller and less organized than in May-Hegglin anomaly. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MHA and SBS.
Any additional useful information about the variant.



Sequence information

Variant position:  373
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1960
The length of the canonical sequence.

Location on the sequence:   VFKKERNTDQASMPDNTAAQ  K VSHLLGINVTDFTRGILTPR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPR

Mouse                         AFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPR

Rat                           VFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPR

Dog                           VFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPR

Chicken                       VFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 1960 Myosin-9
Domain 81 – 776 Myosin motor


Literature citations

Nonmuscle myosin heavy chain IIA mutations define a spectrum of autosomal dominant macrothrombocytopenias: May-Hegglin anomaly and Fechtner, Sebastian, Epstein, and Alport-like syndromes.
Heath K.E.; Campos-Barros A.; Toren A.; Rozenfeld-Granot G.; Carlsson L.E.; Savige J.; Denison J.C.; Gregory M.C.; White J.G.; Barker D.F.; Greinacher A.; Epstein C.J.; Glucksman M.J.; Martignetti J.A.;
Am. J. Hum. Genet. 69:1033-1045(2001)
Cited for: VARIANTS MHA/SBS/FTNS/EPS/APSM ASN-373; CYS-702; HIS-702; PRO-1114; ASN-1424; HIS-1424 AND LYS-1841;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.