UniProtKB/Swiss-Prot P35916: Variant p.Gly857Arg

Vascular endothelial growth factor receptor 3
Gene: FLT4
Chromosomal location: 5q34-q35
Variant information

Variant position:  857
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Glycine (G) to Arginine (R) at position 857 (G857R, p.Gly857Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Lymphedema, hereditary, 1A (LMPH1A) [MIM:153100]: A chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment. {ECO:0000269|PubMed:10835628, ECO:0000269|PubMed:10856194, ECO:0000269|PubMed:16924388, ECO:0000269|PubMed:16965327, ECO:0000269|PubMed:17458866, ECO:0000269|PubMed:19289394, ECO:0000269|PubMed:26091405, ECO:0000269|PubMed:9817924}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In LMPH1A; loss of kinase activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  857
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1363
The length of the canonical sequence.

Location on the sequence:   QWEFPRERLHLGRVLGYGAF  G KVVEASAFGIHKGSSCDTVA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         QWEFPRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVA

Mouse                         QWEFPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVA

Rat                           QWEFPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVA

Zebrafish                     QWEISRDRLRLGKVLGHGAFGKVIEASIFGHDKKSSANTVA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 25 – 1363 Vascular endothelial growth factor receptor 3
Topological domain 797 – 1363 Cytoplasmic
Domain 845 – 1173 Protein kinase
Nucleotide binding 851 – 859 ATP
Modified residue 853 – 853 Phosphotyrosine; by SRC
Alternative sequence 766 – 1298 Missing. In isoform 3.


Literature citations

Activation of vascular endothelial growth factor receptor-3 and its downstream signaling promote cell survival under oxidative stress.
Wang J.F.; Zhang X.; Groopman J.E.;
J. Biol. Chem. 279:27088-27097(2004)
Cited for: FUNCTION IN CELL SURVIVAL; PHOSPHORYLATION IN RESPONSE TO OXIDATIVE STRESS; INTERACTION WITH PIK3R1; SHC1; GRB2; PTPN11 AND PLCG1; ENZYME REGULATION BY MAZ51; CHARACTERIZATION OF VARIANT LMPH1A ARG-857;

Missense mutations interfere with VEGFR-3 signalling in primary lymphoedema.
Karkkainen M.J.; Ferrell R.E.; Lawrence E.C.; Kimak M.A.; Levinson K.L.; McTigue M.A.; Alitalo K.; Finegold D.N.;
Nat. Genet. 25:153-159(2000)
Cited for: VARIANTS LMPH1A ARG-857; PRO-1041; PRO-1044 AND LEU-1114; VARIANT SER-641; CHARACTERIZATION OF VARIANTS;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.