Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P15056: Variant p.Val600Glu

Serine/threonine-protein kinase B-raf
Gene: BRAF
Feedback?
Variant information Variant position: help 600
Type of variant: help LP/P [Disclaimer]
Residue change: help From Valine (V) to Glutamate (E) at position 600 (V600E, p.Val600Glu).
Physico-chemical properties: help Change from medium size and hydrophobic (V) to medium size and acidic (E)
BLOSUM score: help -2
Variant description: help In CRC; also found in sarcoma, metastatic melanoma, ovarian serous carcinoma, pilocytic astrocytoma; somatic mutation; most common mutation; constitutive and elevated kinase activity; efficiently induces cell transformation; suppression of mutation in melanoma causes growth arrest and promotes apoptosis; loss of regulation by PMRT5.
Other resources: help


Sequence information Variant position: help 600
Protein sequence length: help 766
Location on the sequence: help NNIFLHEDLTVKIGDFGLAT V KSRWSGSHQFEQLSGSILWM
Residue conservation: help
Human                         NNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWM

Mouse                         NNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWM

Chicken                       NNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWM

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 2 – 766 Serine/threonine-protein kinase B-raf
Domain 457 – 717 Protein kinase
Turn 598 – 600



Literature citations
Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
Andreu-Perez P.; Esteve-Puig R.; de Torre-Minguela C.; Lopez-Fauqued M.; Bech-Serra J.J.; Tenbaum S.; Garcia-Trevijano E.R.; Canals F.; Merlino G.; Avila M.A.; Recio J.A.;
Sci. Signal. 4:RA58-RA58(2011)
Cited for: INTERACTION WITH PRMT5; METHYLATION AT ARG-671; CHARACTERIZATION OF VARIANT CRC GLU-600; MUTAGENESIS OF ARG-671; Mutations of the BRAF gene in human cancer.
Davies H.; Bignell G.R.; Cox C.; Stephens P.; Edkins S.; Clegg S.; Teague J.; Woffendin H.; Garnett M.J.; Bottomley W.; Davis N.; Dicks E.; Ewing R.; Floyd Y.; Gray K.; Hall S.; Hawes R.; Hughes J.; Kosmidou V.; Menzies A.; Mould C.; Parker A.; Stevens C.; Watt S.; Hooper S.; Wilson R.; Jayatilake H.; Gusterson B.A.; Cooper C.; Shipley J.; Hargrave D.; Pritchard-Jones K.; Maitland N.; Chenevix-Trench G.; Riggins G.J.; Bigner D.D.; Palmieri G.; Cossu A.; Flanagan A.; Nicholson A.; Ho J.W.C.; Leung S.Y.; Yuen S.T.; Weber B.L.; Seigler H.F.; Darrow T.L.; Paterson H.; Marais R.; Marshall C.J.; Wooster R.; Stratton M.R.; Futreal P.A.;
Nature 417:949-954(2002)
Cited for: VARIANTS CANCER GLU-464; VAL-464; ALA-466; GLU-466; VAL-466; ALA-469; GLU-469; LYS-586; LEU-595; ARG-596; ARG-597; VAL-597; GLU-600 AND ASP-600; CHARACTERIZATION OF VARIANTS CANCER VAL-464; ALA-469; VAL-597 AND GLU-600; Tumorigenesis: RAF/RAS oncogenes and mismatch-repair status.
Rajagopalan H.; Bardelli A.; Lengauer C.; Kinzler K.W.; Vogelstein B.; Velculescu V.E.;
Nature 418:934-934(2002)
Cited for: VARIANTS CRC ILE-462; SER-463; GLU-464; GLU-600 AND GLU-601; Suppression of BRAF(V599E) in human melanoma abrogates transformation.
Hingorani S.R.; Jacobetz M.A.; Robertson G.P.; Herlyn M.; Tuveson D.A.;
Cancer Res. 63:5198-5202(2003)
Cited for: CHARACTERIZATION OF VARIANT MELANOMA GLU-600; The consensus coding sequences of human breast and colorectal cancers.
Sjoeblom T.; Jones S.; Wood L.D.; Parsons D.W.; Lin J.; Barber T.D.; Mandelker D.; Leary R.J.; Ptak J.; Silliman N.; Szabo S.; Buckhaults P.; Farrell C.; Meeh P.; Markowitz S.D.; Willis J.; Dawson D.; Willson J.K.V.; Gazdar A.F.; Hartigan J.; Wu L.; Liu C.; Parmigiani G.; Park B.H.; Bachman K.E.; Papadopoulos N.; Vogelstein B.; Kinzler K.W.; Velculescu V.E.;
Science 314:268-274(2006)
Cited for: VARIANT [LARGE SCALE ANALYSIS] GLU-600; Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-301; ALA-469; VAL-469; SER-581; ARG-596; ARG-597; VAL-597 AND GLU-600; Germline mutations affecting the proofreading domains of POLE and POLD1 predispose to colorectal adenomas and carcinomas.
Palles C.; Cazier J.B.; Howarth K.M.; Domingo E.; Jones A.M.; Broderick P.; Kemp Z.; Spain S.L.; Guarino Almeida E.; Salguero I.; Sherborne A.; Chubb D.; Carvajal-Carmona L.G.; Ma Y.; Kaur K.; Dobbins S.; Barclay E.; Gorman M.; Martin L.; Kovac M.B.; Humphray S.; Lucassen A.; Holmes C.C.; Bentley D.; Donnelly P.; Taylor J.; Petridis C.; Roylance R.; Sawyer E.J.; Kerr D.J.; Clark S.; Grimes J.; Kearsey S.E.; Thomas H.J.; McVean G.; Houlston R.S.; Tomlinson I.;
Nat. Genet. 45:136-144(2013)
Cited for: VARIANT CRC GLU-600; Evidence that GRIN2A mutations in melanoma correlate with decreased survival.
D'mello S.A.; Flanagan J.U.; Green T.N.; Leung E.Y.; Askarian-Amiri M.E.; Joseph W.R.; McCrystal M.R.; Isaacs R.J.; Shaw J.H.; Furneaux C.E.; During M.J.; Finlay G.J.; Baguley B.C.; Kalev-Zylinska M.L.;
Front. Oncol. 3:333-333(2014)
Cited for: VARIANT CRC GLU-600;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.