UniProtKB/Swiss-Prot Q9NZC9: Variant p.Ile548Asn

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
Gene: SMARCAL1
Chromosomal location: 2q35
Variant information

Variant position:  548
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Isoleucine (I) to Asparagine (N) at position 548 (I548N, p.Ile548Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (I) to medium size and polar (N)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Schimke immuno-osseous dysplasia (SIOD) [MIM:242900]: Causes spondyloepiphyseal dysplasia, renal dysfunction and T-cell immunodeficiency. Approximately half of all patients also exhibit hyperthyroidism, while around half also exhibit episodal cerebral ischemia. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SIOD.
Any additional useful information about the variant.



Sequence information

Variant position:  548
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  954
The length of the canonical sequence.

Location on the sequence:   SFDLLSKLEKQLKTPFKVVI  I DESHFLKNSRTARCRAAMPV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SFDLLSKLEKQLKTP-FKVVIIDESHFLKNSRTARCRAAMPV

Mouse                         SFDLLCKLERQLKTP-FKVVIIDESHFLKNIKTARCRAAVP

Rat                           SFDLLSKLEKQLKTP-FKVVIIDESHFLKNIKTARCRAAVP

Bovine                        SFDLLSKLEKQLKPP-FKVVIIDESHFLKNIKTAVC-AAMP

Xenopus laevis                SFDLLGKMDKQIAAN-FKVIIIDESHFLKNVKTARCKAAMP

Xenopus tropicalis            SFDLLGKMDKQIAAT-FQVIIIDESHFLKNVKTARCKAAMP

Zebrafish                     SYDLLNKMDKQPPSSPFNVIIMDESHFLKNMKTARCRAALP

Caenorhabditis elegans        SYEQMVLKHDILKKEKYRTIIFDESHMLKDGKARRTKVATD

Drosophila                    SYNMMERHEDKLMQRKFGFIIFDESHTLKNSKAKCTTTAKR

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 954 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
Domain 445 – 600 Helicase ATP-binding


Literature citations

Mutant chromatin remodeling protein SMARCAL1 causes Schimke immuno-osseous dysplasia.
Boerkoel C.F.; Takashima H.; John J.; Yan J.; Stankiewicz P.; Rosenbarker L.; Andre J.-L.; Bogdanovic R.; Burguet A.; Cockfield S.; Cordeiro I.; Frund S.; Illies F.; Joseph M.; Kaitila I.; Lama G.; Loirat C.; McLeod D.R.; Milford D.V.; Petty E.M.; Rodrigo F.; Saraiva J.M.; Schmidt B.; Smith G.C.; Spranger J.; Stein A.; Thiele H.; Tizard J.; Weksberg R.; Lupski J.R.; Stockton D.W.;
Nat. Genet. 30:215-220(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; TISSUE SPECIFICITY; VARIANTS SIOD PRO-468; ASN-548; LEU-579; TRP-586; TRP-644; CYS-645; GLN-647; THR-647; ILE-705; GLN-764 AND HIS-820;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.