Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P07202: Variant p.Asn307Thr

Thyroid peroxidase
Gene: TPO
Feedback?
Variant information Variant position: help 307 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Threonine (T) at position 307 (N307T, p.Asn307Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and polar. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In TDH2A. Any additional useful information about the variant.


Sequence information Variant position: help 307 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 933 The length of the canonical sequence.
Location on the sequence: help LPFYRSSAACGTGDQGALFG N LSTANPRQQMNGLTSFLDAS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LPFYRSSAACGTGDQGALFGNLSTANPRQQMNGLTSFLDAS

                              LPFSRSSAACGTGIQGAFFGNLSSANPRQQMNGLTSFLDAS

Mouse                         LPFYRSSAACGTGDQGALFGNLSAANPRQQMNGLTSFLDAS

Rat                           LPFYRSSAACGTGDQGALFGNLSAANPRQQMNGLTSFLDAS

Pig                           LPFYRSSAACGSGRQGALVGNLSWAAPRQQMNGLTSFLDAS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 19 – 933 Thyroid peroxidase
Topological domain 19 – 846 Extracellular
Binding site 321 – 321
Binding site 323 – 323
Binding site 325 – 325
Binding site 327 – 327
Glycosylation 307 – 307 N-linked (GlcNAc...) asparagine
Alternative sequence 274 – 446 Missing. In isoform 5.



Literature citations
Five novel inactivating mutations in the thyroid peroxidase gene responsible for congenital goiter and iodide organification defect.
Rivolta C.M.; Esperante S.A.; Gruneiro-Papendieck L.; Chiesa A.; Moya C.M.; Domene S.; Varela V.; Targovnik H.M.;
Hum. Mutat. 22:259-259(2003)
Cited for: VARIANTS TDH2A THR-307; MET-433; LEU-499 AND ARG-808;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.