Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P54315: Variant p.Glu414Asp

Inactive pancreatic lipase-related protein 1
Gene: PNLIPRP1
Feedback?
Variant information Variant position: help 414 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Aspartate (D) at position 414 (E414D, p.Glu414Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and acidic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 414 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 467 The length of the canonical sequence.
Location on the sequence: help LKPGSTHSYEFDAKLDVGTI E KVKFLWNNNVINPTLPKVGA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LKPGSTHSYEFDAKLDVGTIEKVKFLWNNNVINPTLPKVGA

                              LKPGSTHSNEFDAKLDVGTIEKVKFLWNNNVVNPTFPKVGA

Mouse                         IKPGATHSNEFDAKLDVGTIEKVKFLWNNHVVNPSFPKVGA

Rat                           IKPGATHSSEFDAKLDVGTIEKVKFLWNNQVINPSFPKVGA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 18 – 467 Inactive pancreatic lipase-related protein 1
Domain 356 – 467 PLAT
Binding site 421 – 421
Binding site 422 – 422
Binding site 422 – 422
Binding site 424 – 424
Binding site 426 – 426
Alternative sequence 118 – 467 Missing. In isoform 3.
Alternative sequence 187 – 467 Missing. In isoform 2.
Beta strand 412 – 421



Literature citations
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2); VARIANT ASP-414;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.