UniProtKB/Swiss-Prot Q9NQ86: Variant p.Lys428Arg

E3 ubiquitin-protein ligase TRIM36
Gene: TRIM36
Feedback?

Variant information Variant position:

428 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Lysine (K) to Arginine (R) at position 428 (K428R, p.Lys428Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs79290430 [ dbSNP | Ensembl ]

Sequence information Variant position:

428 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

728 The length of the canonical sequence.
Location on the sequence:

GELSFFSSGIDVPEINEEQS K VYNNALINWHHPEKDKADSY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GELSFFSSGIDVPEINEEQSKVYNNALINWHHPEKDKADSY

Mouse                         GELSFFSSGIDIPEINEEQSKVYNNALIDWHHPEKDKADSY

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 728	E3 ubiquitin-protein ligase TRIM36
Domain	419 – 510	Fibronectin type-III
Alternative sequence	61 – 728	Missing. In isoform 2.
Alternative sequence	62 – 728	Missing. In isoform 3.

Literature citations
Cloning and characterisation of the RBCC728/TRIM36 zinc-binding protein from the tumor suppressor gene region at chromosome 5q22.3.
Balint I.; Muller A.; Nagy A.; Kovacs G.;
Gene 332:45-50(2004)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); SUBCELLULAR LOCATION; TISSUE SPECIFICITY; VARIANTS ARG-428; SER-456 AND ASN-678; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2); VARIANTS ARG-428 AND ASN-678;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.