UniProtKB/Swiss-Prot Q8IWV7: Variant p.His136Arg

E3 ubiquitin-protein ligase UBR1
Gene: UBR1
Chromosomal location: 15q15-q21.1
Variant information

Variant position:  136
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Histidine (H) to Arginine (R) at position 136 (H136R, p.His136Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Johanson-Blizzard syndrome (JBS) [MIM:243800]: This disorder includes congenital exocrine pancreatic insufficiency, multiple malformations such as nasal wing aplasia, and frequent mental retardation. Pancreas of individuals with JBS do not express UBR1 and show intrauterine-onset destructive pancreatitis. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In JBS; prevents proper folding of the UBR-type zinc finger.
Any additional useful information about the variant.



Sequence information

Variant position:  136
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1749
The length of the canonical sequence.

Location on the sequence:   AIDPTCVLCMDCFQDSVHKN  H RYKMHTSTGGGFCDCGDTEA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AIDPTCVLCMDCFQDSVHKNHRYKMHTSTG--GGFCDCGDTEA

Mouse                         AIDPTCVLCMDCFQSSVHKNHRYKMHTSTG--GGFCDCGDT

Caenorhabditis elegans        ATDGTCVMCLQCFEVSIHKSHKYKMHSSSG--SGYCDCGDA

Drosophila                    GVDPTCVLCVNCFKRSAHRFHKYKMSTSGG--GGCCDCGDD

Baker's yeast                 GCDDTCVLCIHCFNPKDHVNHHVCTDICTEFTSGICDCGDE

Fission yeast                 SVDSNSALCVKCFRATSHKDHETSFTVSAG-SGGCCDCGNA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 1749 E3 ubiquitin-protein ligase UBR1
Zinc finger 97 – 168 UBR-type


Literature citations

Structural basis of substrate recognition and specificity in the N-end rule pathway.
Matta-Camacho E.; Kozlov G.; Li F.F.; Gehring K.;
Nat. Struct. Mol. Biol. 17:1182-1187(2010)
Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 98-167 ALONE AND IN COMPLEX WITH N-END RULE PEPTIDE; UBR-TYPE ZINC-FINGER; FUNCTION; VARIANT JB5 ARG-136;

Deficiency of UBR1, a ubiquitin ligase of the N-end rule pathway, causes pancreatic dysfunction, malformations and mental retardation (Johanson-Blizzard syndrome).
Zenker M.; Mayerle J.; Lerch M.M.; Tagariello A.; Zerres K.; Durie P.R.; Beier M.; Hulskamp G.; Guzman C.; Rehder H.; Beemer F.A.; Hamel B.C.J.; Vanlieferinghen P.; Gershoni-Baruch R.; Vieira M.W.; Dumic M.; Auslender R.; Gil-da-Silva-Lopes V.L.; Steinlicht S.; Rauh M.; Shalev S.A.; Thiel C.; Winterpacht A.; Kwon Y.T.; Varshavsky A.; Reis A.;
Nat. Genet. 37:1345-1350(2005)
Cited for: VARIANTS JBS ARG-136 AND SER-1279; FUNCTION; DISEASE; TISSUE SPECIFICITY; SUBCELLULAR LOCATION; DEVELOPMENTAL STAGE;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.