UniProtKB/Swiss-Prot Q9UQ84: Variant p.Val458Met

Exonuclease 1
Gene: EXO1
Feedback?

Variant information Variant position:

458 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Methionine (M) at position 458 (V458M, p.Val458Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Most naturally occurring variants in this protein are not associated with familial disposition to hereditary non-polyposis colorectal cancer (HNPCC) (PubMed:12517792). Furthermore, germline deletions involving this locus are not associated with clinically manifested colorectal tumors (PubMed:14623461). Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs4149965 [ dbSNP | Ensembl ]

Sequence information Variant position:

458 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

846 The length of the canonical sequence.
Location on the sequence:

FTKKTKKNSSEGNKSLSFSE V FVPDLVNGPTNKKSVSTPPR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FTKKTKKNSSEGNK-------SLSFSEVFVPDLVNGPTNKKSVSTPPR

Mouse                         VSKKIKENGCGDGT-------SPNSSKMSKSCPDSGTAHKT

Xenopus laevis                KNKKARPDGDDPMQQ------VPASTMILQPLDDCANTKPK

Zebrafish                     VKRHCPET-------------QPTTKPLTNDNKVSKENHCG

Drosophila                    AKRRRSPSREDSVDQERTPPPSPVHKSRHNPFAKERTGEEA

Slime mold                    NQENVLESDCEFDDDDDQRGIDVDDSEKKDSFVLDSDYEDE

Baker's yeast                 VQETLKDTRSKFFNK-PSMTVVENFKEKGDSIQDFKEDTNS

Fission yeast                 EKAYVTPKSNSL---------KPGFGKSLSDISNSATKNEN

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 846	Exonuclease 1
Region	388 – 490	Interaction with MLH1
Modified residue	454 – 454	Phosphoserine
Mutagenesis	454 – 454	S -> A. No rescue of HU-induced degradation. No rescue of HU-induced degradation; when associated with A-714. Loss of HU-sensitivity and resistance to HU-induced degradation; when associated with A-621 and A-714.

Literature citations
Submission
NIEHS SNPs program;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS ILE-76; GLY-93; SER-279; SER-299; ARG-354; ASN-428; MET-439; TYR-456; MET-458; LEU-460; THR-503; LYS-589; GLN-634; GLY-670; CYS-723; LEU-757 AND GLU-759;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.