UniProtKB/Swiss-Prot Q8NFG4: Variant p.Ala238Val

Folliculin
Gene: FLCN
Chromosomal location: 17p11.2
Variant information

Variant position:  238
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Alanine (A) to Valine (V) at position 238 (A238V, p.Ala238Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and hydrophobic (V)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Renal cell carcinoma (RCC) [MIM:144700]: Renal cell carcinoma is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. Clear cell renal cell carcinoma is the most common subtype. Note=The gene represented in this entry may be involved in disease pathogenesis.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In a renal cell carcinoma cell line.
Any additional useful information about the variant.



Sequence information

Variant position:  238
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  579
The length of the canonical sequence.

Location on the sequence:   RAQRMNTAFTPFLHQRNGNA  A RSLTSLTSDDNLWACLHTSF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSF

Mouse                         RAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSF

Rat                           RAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSF

Bovine                        RAQRMNTAFTPFLHQRNGNAARSLTSLTNDDSLWACLHTSF

Xenopus tropicalis            RPLRINTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 579 Folliculin
Alternative sequence 198 – 579 Missing. In isoform 3.


Literature citations

Analysis of the Birt-Hogg-Dube (BHD) tumour suppressor gene in sporadic renal cell carcinoma and colorectal cancer.
da Silva N.F.; Gentle D.; Hesson L.B.; Morton D.G.; Latif F.; Maher E.R.;
J. Med. Genet. 40:820-824(2003)
Cited for: POSSIBLE INVOLVEMENT IN RENAL CELL CARCINOMA AND COLORECTAL CANCER; VARIANTS VAL-238; GLN-320; GLY-392 AND SER-444;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.