Sequence information:
(Click the titles to show more information.)
Variant position: 748The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 1210The length of the canonical sequence.
Location on the sequence:
KGLWIPEGEKVKIPVAIKEL
R EATSPKANKEILDEAYVMAS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human KGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMAS
Mouse KGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMAS
Drosophila KGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMAS
Sequence annotation in neighborhood:The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:- Type: the type of sequence feature.
- Positions: endpoints of the sequence feature.
- Description: contains additional information about the feature.
| Type | Positions | Description |
| Chain |
25 – 1210 |
Epidermal growth factor receptor |
| Topological domain |
669 – 1210 |
Cytoplasmic |
| Domain |
712 – 979 |
Protein kinase |
| Binding site |
745 – 745 |
ATP |
| Cross |
737 – 737 |
Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) |
| Cross |
754 – 754 |
Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) |
| Alternative sequence |
406 – 1210 |
Missing. In isoform 2. |
| Alternative sequence |
629 – 1210 |
Missing. In isoform 4. |
| Alternative sequence |
706 – 1210 |
Missing. In isoform 3. |
| Mutagenesis |
745 – 745 |
K -> AM. Abolishes kinase activity. |
| Beta strand |
748 – 750 |
|
Literature citations
Distinct epidermal growth factor receptor and KRAS mutation patterns in non-small cell lung cancer patients with different tobacco exposure and clinicopathologic features.
Tam I.Y.S.; Chung L.P.; Suen W.S.; Wang E.; Wong M.C.M.; Ho K.K.; Lam W.K.; Chiu S.W.; Girard L.; Minna J.D.; Gazdar A.F.; Wong M.P.;
Clin. Cancer Res. 12:1647-1653(2006)
Cited for: VARIANTS ALA-709; LYS-709; ALA-719; ASP-719; CYS-719; SER-719; SER-724; LYS-734; GLU-746 DEL; PHE-747; 747-LEU--GLU-749 DEL; PRO-748; 752-SER--ILE-759 DEL; ARG-787; MET-790; VAL-833; LEU-834; MET-858; ARG-858; GLN-861 AND GLU-873; POSSIBLE INVOLVEMENT IN LUNG CANCER;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.