Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P60484: Variant p.Val369Gly

Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Gene: PTEN
Feedback?
Variant information Variant position: help 369 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Glycine (G) at position 369 (V369G, p.Val369Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (V) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Retains Ins(1,3,4,5)P4 and PtdIns(3,4,5)P3 phosphatase activity; retains ability to bind phospholipid membranes. Any additional useful information about the variant.


Sequence information Variant position: help 369 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 403 The length of the canonical sequence.
Location on the sequence: help KTVEEPSNPEASSSTSVTPD V SDNEPDHYRYSDTTDSDPEN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         KTVEEPS----NPEASSS-------TSVTPDVSDN------EPDHYRYSDTTDSDPEN

                              KTVEEPS----NPEASSS-------TSVTPDVSDN------

Mouse                         KTVEEPS----NPEASSS-------TSVTPDVSDN------

Rat                           KTVEEPS----NPEASSS-------TSVTPDVSDN------

Xenopus laevis                KTVEESS----NSEASSS-------TSVTPDVSDN------

Caenorhabditis elegans        HVVEESNGSSKNPKALKTREQMVKETGKDTQKTRNHVLLHL

Slime mold                    SSQSNPV----QQESNPS---------TTTQVS--------

Fission yeast                 PMLVEYT------------------NGINFQQGINSFLQGQ

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 403 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Region 352 – 403 Disordered
Compositional bias 360 – 369 Low complexity
Modified residue 366 – 366 Phosphothreonine; by GSK3-beta and PLK3
Modified residue 370 – 370 Phosphoserine; by CK2 and PLK3
Modified residue 380 – 380 Phosphoserine; by ROCK1 and CK2
Modified residue 382 – 382 Phosphothreonine; by ROCK1 and CK2
Modified residue 383 – 383 Phosphothreonine; by ROCK1 and CK2
Modified residue 385 – 385 Phosphoserine; by CK2
Alternative sequence 191 – 403 Missing. In isoform 3.
Mutagenesis 366 – 366 T -> A. Decreased stability.
Mutagenesis 370 – 370 S -> A. Decreased stability.



Literature citations
Functional evaluation of PTEN missense mutations using in vitro phosphoinositide phosphatase assay.
Han S.-Y.; Kato H.; Kato S.; Suzuki T.; Shibata H.; Ishii S.; Shiiba K.; Matsuno S.; Kanamaru R.; Ishioka C.;
Cancer Res. 60:3147-3151(2000)
Cited for: CHARACTERIZATION OF VARIANTS ASN-10; CYS-16; GLU-20; SER-27; ARG-61; HIS-68; ARG-112; PRO-121; ARG-129; GLY-130; ILE-133; LEU-134; ARG-165; ASN-170; CYS-173; HIS-173; PRO-173; ASN-174; PHE-227; CYS-251; GLN-345; GLY-369 AND ILE-401; CHARACTERIZATION OF VARIANTS CWS1 TYR-71; TYR-93; PHE-105; TYR-107; PRO-112; ARG-124; GLU-129; LEU-130; GLN-130; TYR-136; CYS-155; ARG-170; GLU-289; GLY-331; VAL-341; ASN-342; GLU-343 AND LEU-347;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.