To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot O00421: Variant p.Phe167Tyr

C-C chemokine receptor-like 2
Gene: CCRL2
Chromosomal location: 3p21
Variant information

Variant position:  167
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Phenylalanine (F) to Tyrosine (Y) at position 167 (F167Y, p.Phe167Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are large size and aromatic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  167
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  344
The length of the canonical sequence.

Location on the sequence:   CGIITSVLAWVTAILATLPE  F VVYKPQMEDQKYKCAFSRTP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         CGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTP

Rhesus macaque                CGIVTSAVAWVTAILATVPEFAVYKPQMEDPKYKCAFSRTP

Mouse                         CGIVACILAWAMATALSLPESVFYEPRMERQKHKCAFGKPH

Pig                           GSIFPSALVWVIAVLVMLPELAFYKPQMENQKYKCFFGRPL

Bovine                        GSIFISVLVWVTATLVTLPELVSYKPQMQSQKYKCFFTGLH

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 344 C-C chemokine receptor-like 2
Topological domain 166 – 198 Extracellular
Disulfide bond 103 – 181


Literature citations

Cloning and characterization of a novel human chemokine receptor.
Fan P.; Kyaw H.; Su K.; Zeng Z.; Augustus M.; Carter K.C.; Li Y.;
Biochem. Biophys. Res. Commun. 243:264-268(1998)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); TISSUE SPECIFICITY; VARIANT TYR-167;

Haplotype analysis of a gene cluster containing CCR5 and a new member of chemokine receptor gene family.
Ansari-Lari M.A.; Liu X.-M.; Gorrell J.H.; Gibbs R.A.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT TYR-167;

cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org).
Kopatz S.A.; Aronstam R.S.; Sharma S.V.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT TYR-167;

The DNA sequence, annotation and analysis of human chromosome 3.
Muzny D.M.; Scherer S.E.; Kaul R.; Wang J.; Yu J.; Sudbrak R.; Buhay C.J.; Chen R.; Cree A.; Ding Y.; Dugan-Rocha S.; Gill R.; Gunaratne P.; Harris R.A.; Hawes A.C.; Hernandez J.; Hodgson A.V.; Hume J.; Jackson A.; Khan Z.M.; Kovar-Smith C.; Lewis L.R.; Lozado R.J.; Metzker M.L.; Milosavljevic A.; Miner G.R.; Morgan M.B.; Nazareth L.V.; Scott G.; Sodergren E.; Song X.-Z.; Steffen D.; Wei S.; Wheeler D.A.; Wright M.W.; Worley K.C.; Yuan Y.; Zhang Z.; Adams C.Q.; Ansari-Lari M.A.; Ayele M.; Brown M.J.; Chen G.; Chen Z.; Clendenning J.; Clerc-Blankenburg K.P.; Chen R.; Chen Z.; Davis C.; Delgado O.; Dinh H.H.; Dong W.; Draper H.; Ernst S.; Fu G.; Gonzalez-Garay M.L.; Garcia D.K.; Gillett W.; Gu J.; Hao B.; Haugen E.; Havlak P.; He X.; Hennig S.; Hu S.; Huang W.; Jackson L.R.; Jacob L.S.; Kelly S.H.; Kube M.; Levy R.; Li Z.; Liu B.; Liu J.; Liu W.; Lu J.; Maheshwari M.; Nguyen B.-V.; Okwuonu G.O.; Palmeiri A.; Pasternak S.; Perez L.M.; Phelps K.A.; Plopper F.J.; Qiang B.; Raymond C.; Rodriguez R.; Saenphimmachak C.; Santibanez J.; Shen H.; Shen Y.; Subramanian S.; Tabor P.E.; Verduzco D.; Waldron L.; Wang J.; Wang J.; Wang Q.; Williams G.A.; Wong G.K.-S.; Yao Z.; Zhang J.; Zhang X.; Zhao G.; Zhou J.; Zhou Y.; Nelson D.; Lehrach H.; Reinhardt R.; Naylor S.L.; Yang H.; Olson M.; Weinstock G.; Gibbs R.A.;
Nature 440:1194-1198(2006)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]; VARIANT TYR-167;

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANTS TYR-167 AND MET-168;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.