Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P51168: Variant p.Pro618Arg

Amiloride-sensitive sodium channel subunit beta
Gene: SCNN1B
Feedback?
Variant information Variant position: help 618 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Arginine (R) at position 618 (P618R, p.Pro618Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In LIDLS1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 618 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 640 The length of the canonical sequence.
Location on the sequence: help SPNTGPYPSEQALPIPGTPP P NYDSLRLQPLDVIESDSEGD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         SPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGD

                              GPDPGTYPDEQTLPIPGTPPPNYDSLRLQPLDVIESDSEGD

Chimpanzee                    SPNTGPYPNEQALPIPGTPPPNYDSLRLQPLDVIESDSEGD

Mouse                         RPHGEVYPDQQTLPIPGTPPPNYDSLRLQPLDTMESDSEVE

Rat                           RPNAEVYPDQQTLPIPGTPPPNYDSLRLQPLDTMESDSEVE

Bovine                        GPDVEAYPHEQNPPIPGTPPPNYDSLRLQPLDVIESDSEGD

Rabbit                        SPDAEAYPDEQALPIPGTPPPNYDSLRLQPLDVVESDSEGD

Sheep                         GPDAGAYRREQNPPIPGTPPPNYDSLRLQPLDVIESDSEGD

Xenopus laevis                VP----------VDIPGTPPPNYDSLRVNTAEPVSSDEEN-
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 640 Amiloride-sensitive sodium channel subunit beta
Topological domain 554 – 640 Cytoplasmic
Region 590 – 640 Disordered
Modified residue 633 – 633 Phosphoserine
Modified residue 635 – 635 Phosphoserine



Literature citations
Liddle's syndrome caused by a novel mutation in the proline-rich PY motif of the epithelial sodium channel beta-subunit.
Furuhashi M.; Kitamura K.; Adachi M.; Miyoshi T.; Wakida N.; Ura N.; Shikano Y.; Shinshi Y.; Sakamoto K.; Hayashi M.; Satoh N.; Nishitani T.; Tomita K.; Shimamoto K.;
J. Clin. Endocrinol. Metab. 90:340-344(2005)
Cited for: VARIANT LIDLS1 ARG-618;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.