Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q5VWK5: Variant p.Arg381Gln

Interleukin-23 receptor
Gene: IL23R
Feedback?
Variant information Variant position: help 381 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Glutamine (Q) at position 381 (R381Q, p.Arg381Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Protective factor against IBD17; protective factor against psoriasis. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 381 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 629 The length of the canonical sequence.
Location on the sequence: help IVFAVMLSILSLIGIFNRSF R TGIKRRILLLIPKWLYEDIP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIP

Mouse                         VFLAIMLPIFSLIGIFNRSLRIGIKRKVLLMIPKWLYEDIP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 24 – 629 Interleukin-23 receptor
Topological domain 377 – 629 Cytoplasmic
Alternative sequence 1 – 402 Missing. In isoform 7.
Alternative sequence 175 – 629 Missing. In isoform 4.
Alternative sequence 357 – 629 Missing. In isoform 3.
Alternative sequence 366 – 383 MLSILSLIGIFNRSFRTG -> MEFWANSCFHLYRAPYFW. In isoform 5.



Literature citations
A genome-wide association study identifies IL23R as an inflammatory bowel disease gene.
Duerr R.H.; Taylor K.D.; Brant S.R.; Rioux J.D.; Silverberg M.S.; Daly M.J.; Steinhart A.H.; Abraham C.; Regueiro M.; Griffiths A.; Dassopoulos T.; Bitton A.; Yang H.; Targan S.; Datta L.W.; Kistner E.O.; Schumm L.P.; Lee A.T.; Gregersen P.K.; Barmada M.M.; Rotter J.I.; Nicolae D.L.; Cho J.H.;
Science 314:1461-1463(2006)
Cited for: INVOLVEMENT IN IBD17; VARIANTS HIS-3; PRO-310 AND GLN-381; CHARACTERIZATION OF VARIANT GLN-381; Sequence variants in the genes for the interleukin-23 receptor (IL23R) and its ligand (IL12B) confer protection against psoriasis.
Capon F.; Di Meglio P.; Szaub J.; Prescott N.J.; Dunster C.; Baumber L.; Timms K.; Gutin A.; Abkevic V.; Burden A.D.; Lanchbury J.; Barker J.N.; Trembath R.C.; Nestle F.O.;
Hum. Genet. 122:201-206(2007)
Cited for: VARIANT GLN-381; CHARACTERIZATION OF VARIANT GLN-381; Genome-wide association study for Crohn's disease in the Quebec founder population identifies multiple validated disease loci.
Raelson J.V.; Little R.D.; Ruether A.; Fournier H.; Paquin B.; Van Eerdewegh P.; Bradley W.E.C.; Croteau P.; Nguyen-Huu Q.; Segal J.; Debrus S.; Allard R.; Rosenstiel P.; Franke A.; Jacobs G.; Nikolaus S.; Vidal J.-M.; Szego P.; Laplante N.; Clark H.F.; Paulussen R.J.; Hooper J.W.; Keith T.P.; Belouchi A.; Schreiber S.;
Proc. Natl. Acad. Sci. U.S.A. 104:14747-14752(2007)
Cited for: INVOLVEMENT IN IBD17; VARIANT GLN-381; Genetic variants of the IL-23R pathway: association with psoriatic arthritis and psoriasis vulgaris, but no specific risk factor for arthritis.
Huffmeier U.; Lascorz J.; Bohm B.; Lohmann J.; Wendler J.; Mossner R.; Reich K.; Traupe H.; Kurrat W.; Burkhardt H.; Reis A.;
J. Invest. Dermatol. 129:355-358(2009)
Cited for: VARIANTS PRO-310 AND GLN-381; CHARACTERIZATION OF VARIANT GLN-381;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.