UniProtKB/Swiss-Prot P11362 : Variant p.His621Arg
Fibroblast growth factor receptor 1
Gene: FGFR1
Feedback ?
Variant information
Variant position:
621
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
LP/P [Disclaimer : Variants classification is intended for research purposes only, not for clinical and diagnostic use . The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant. ]
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Histidine (H) to Arginine (R) at position 621 (H621R, p.His621Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Change from medium size and polar (H) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Variant description:
In HH2.
Any additional useful information about the variant.
Sequence information
Variant position:
621
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
822
The length of the canonical sequence.
Location on the sequence:
VSCAYQVARGMEYLASKKCI
H RDLAARNVLVTEDNVMKIAD
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
22 – 822
Fibroblast growth factor receptor 1
Topological domain
398 – 822
Cytoplasmic
Domain
478 – 767
Protein kinase
Active site
623 – 623
Proton acceptor
Binding site
627 – 627
Binding site
641 – 641
Alternative sequence
62 – 822
Missing. In isoform 3.
Alternative sequence
151 – 822
Missing. In isoform 16.
Alternative sequence
392 – 822
Missing. In isoform 17 and isoform 18.
Alternative sequence
619 – 662
CIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL -> VWNLKAPLVHTPRPGSQECPGDRGQCDEDSRLWPRTGHSPHRLL. In isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13.
Mutagenesis
609 – 609
R -> V. Abolishes interaction with PLCG1.
Mutagenesis
623 – 623
D -> A. Loss of kinase activity.
Literature citations
Novel FGFR1 sequence variants in Kallmann syndrome, and genetic evidence that the FGFR1c isoform is required in olfactory bulb and palate morphogenesis.
Dode C.; Fouveaut C.; Mortier G.; Janssens S.; Bertherat J.; Mahoudeau J.; Kottler M.-L.; Chabrolle C.; Gancel A.; Francois I.; Devriendt K.; Wolczynski S.; Pugeat M.; Pineiro-Garcia A.; Murat A.; Bouchard P.; Young J.; Delpech M.; Hardelin J.-P.;
Hum. Mutat. 28:97-98(2007)
Cited for: VARIANTS HH2 PHE-101; TRP-250; ASP-270; ARG-283; 324-GLU--ARG-822 DEL; CYS-332; ARG-621; 661-ARG--ARG-822 DEL; PHE-685 AND PHE-693; VARIANTS LYS-77; SER-772 AND CYS-822;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.