Expasy logo

UniProtKB/Swiss-Prot variant pages

Due to scheduled maintenance work, this service may suffer downtimes today between 07:00 p.m. until 10:00 p.m. CEST.
Apologies for the inconvenience.

UniProtKB/Swiss-Prot P25963: Variant p.Ser32Ile

NF-kappa-B inhibitor alpha
Gene: NFKBIA
Feedback?
Variant information Variant position: help 32 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Isoleucine (I) at position 32 (S32I, p.Ser32Ile). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to medium size and hydrophobic (I) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In EDAID2. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 32 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 317 The length of the canonical sequence.
Location on the sequence: help AMEGPRDGLKKERLLDDRHD S GLDSMKDEEYEQMVKELQEI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AMEGPRDGLKKERLL--DDRHDSGLDSMKDEEYEQMVKELQEI

Mouse                         AMEGPRDGLKKERLV--DDRHDSGLDSMKDEEYEQMVKELR

Rat                           AMEGPRDGLKKERLV--DDRHDSGLDSMKDEDYEQMVKELR

Pig                           AMEGPRDALKKERLL--DDRHDSGLDSMKDEEYEQMVKELR

Chicken                       GCEPPRKE-RQGGLLPPDDRHDSGLDSMKEEEYRQLVRELE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 317 NF-kappa-B inhibitor alpha
Region 1 – 39 Disordered
Motif 30 – 36 Destruction motif
Compositional bias 15 – 39 Basic and acidic residues
Modified residue 32 – 32 Phosphoserine; by IKKA and IKKE
Modified residue 36 – 36 Phosphoserine; by IKKA, IKKB, IKKE and TBK1
Modified residue 42 – 42 Phosphotyrosine; by Tyr-kinases
Cross 21 – 21 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross 21 – 21 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 22 – 22 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis 21 – 21 K -> R. Little change in Tax-stimulated transactivation. No sumoylation. Greatly reduced Tax- or cytokine-stimulated transactivation and decrease in ubiquitination and degradation; when associated with R-22. Does not affect activation by FK506.
Mutagenesis 22 – 22 K -> R. Little change in Tax-stimulated transactivation. No sumoylation. Greatly reduced Tax- or cytokine-stimulated transactivation and decrease in ubiquitination and degradation; when associated with R-21. Does not affect activation by FK506.
Mutagenesis 31 – 31 D -> A. Loss of phosphorylation; when associated with A-35.
Mutagenesis 32 – 32 S -> A. Loss of phosphorylation, ubiquitination and degradation; when associated with A-36. Abolished activation by FK506.
Mutagenesis 32 – 32 S -> E. Mimics phosphorylation; promoting ubiquitination and degradation; when associated with E-36.
Mutagenesis 32 – 32 S -> T. Decrease in phosphorylation and degradation; when associated with T-36.
Mutagenesis 35 – 35 D -> A. Loss in phosphorylation; when associated with A-31.
Mutagenesis 35 – 35 D -> G. No change neither in phosphorylation, nor on degradation.
Mutagenesis 36 – 36 S -> A. Loss of phosphorylation, ubiquitination, and degradation; when associated with A-32. Does not affect activation by FK506.
Mutagenesis 36 – 36 S -> E. Mimics phosphorylation; promoting ubiquitination and degradation; when associated with E-32.
Mutagenesis 36 – 36 S -> T. Decrease in phosphorylation and degradation; when associated with T-32.
Mutagenesis 38 – 38 K -> R. No change in Tax-stimulated transactivation. No change in Tax-stimulated transactivation; when associated with R-47.
Mutagenesis 42 – 42 Y -> F. No phosphorylation.
Mutagenesis 47 – 47 K -> R. Little change in Tax-stimulated transactivation. No change in Tax-stimulated transactivation; when associated with R-38.



Literature citations
A hypermorphic IkappaBalpha mutation is associated with autosomal dominant anhidrotic ectodermal dysplasia and T cell immunodeficiency.
Courtois G.; Smahi A.; Reichenbach J.; Doffinger R.; Cancrini C.; Bonnet M.; Puel A.; Chable-Bessia C.; Yamaoka S.; Feinberg J.; Dupuis-Girod S.; Bodemer C.; Livadiotti S.; Novelli F.; Rossi P.; Fischer A.; Israel A.; Munnich A.; Le Deist F.; Casanova J.L.;
J. Clin. Invest. 112:1108-1115(2003)
Cited for: VARIANT EDAID2 ILE-32;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.