To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot P42345: Variant p.Ser2215Tyr

Serine/threonine-protein kinase mTOR
Gene: MTOR
Chromosomal location: 1p36.2-p36.3
Variant information

Variant position:  2215
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Serine (S) to Tyrosine (Y) at position 2215 (S2215Y, p.Ser2215Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and polar (S) to large size and aromatic (Y)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Focal cortical dysplasia 2 (FCORD2) [MIM:607341]: A form of focal cortical dysplasia, a malformation of cortical development that results in medically refractory epilepsy in the pediatric population and in adults. FCORD2 is a severe form, with onset usually in childhood, characterized by disrupted cortical lamination and specific cytological abnormalities. It is classified in 2 subtypes: type IIA characterized by dysmorphic neurons and lack of balloon cells; type IIB with dysmorphic neurons and balloon cells. {ECO:0000269|PubMed:25799227, ECO:0000269|PubMed:25878179, ECO:0000269|PubMed:26018084, ECO:0000269|PubMed:27830187}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In FCORD2; also found in a colorectal adenocarcinoma sample; somatic mutation; increased TOR signaling.
Any additional useful information about the variant.



Sequence information

Variant position:  2215
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2549
The length of the canonical sequence.

Location on the sequence:   DERVMQLFGLVNTLLANDPT  S LRKNLSIQRYAVIPLSTNSG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Mouse                         DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Rat                           DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2549 Serine/threonine-protein kinase mTOR
Domain 2182 – 2516 PI3K/PI4K
Helix 2213 – 2217


Literature citations

Somatic mutations in the MTOR gene cause focal cortical dysplasia type IIb.
Nakashima M.; Saitsu H.; Takei N.; Tohyama J.; Kato M.; Kitaura H.; Shiina M.; Shirozu H.; Masuda H.; Watanabe K.; Ohba C.; Tsurusaki Y.; Miyake N.; Zheng Y.; Sato T.; Takebayashi H.; Ogata K.; Kameyama S.; Kakita A.; Matsumoto N.;
Ann. Neurol. 78:375-386(2015)
Cited for: FUNCTION; INVOLVEMENT IN FCORD2; VARIANTS FCORD2 ASP-1459; PRO-1460; PHE-2215 AND TYR-2215; CHARACTERIZATION OF VARIANTS FCORD2 ASP-1459; PRO-1460; PHE-2215 AND TYR-2215;

Germline and somatic mutations in the MTOR gene in focal cortical dysplasia and epilepsy.
Moeller R.S.; Weckhuysen S.; Chipaux M.; Marsan E.; Taly V.; Bebin E.M.; Hiatt S.M.; Prokop J.W.; Bowling K.M.; Mei D.; Conti V.; de la Grange P.; Ferrand-Sorbets S.; Dorfmueller G.; Lambrecq V.; Larsen L.H.; Leguern E.; Guerrini R.; Rubboli G.; Cooper G.M.; Baulac S.;
Neurol. Genet. 2:E118-E118(2016)
Cited for: INVOLVEMENT IN FCORD2; VARIANTS GLU-1376 AND VAL-2501; VARIANTS FCORD2 SER-1459; PRO-1460; PHE-2215 AND TYR-2215; VARIANTS SKS ARG-1490; ILE-1595; THR-1832; CYS-1888 AND ILE-2327;

Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-8; THR-135; VAL-1083; VAL-1134; PHE-1178; VAL-2011; TYR-2215 AND LEU-2476;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.