UniProtKB/Swiss-Prot Q13642: Variant p.Cys224Trp

Four and a half LIM domains protein 1
Gene: FHL1
Chromosomal location: Xq27.2
Variant information

Variant position:  224
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Cysteine (C) to Tryptophan (W) at position 224 (C224W, p.Cys224Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Myopathy, X-linked, with postural muscle atrophy (XMPMA) [MIM:300696]: A progressive muscular dystrophy with onset in adulthood. Affected individuals develop a proximal myopathy characterized by specific atrophy of postural muscles, limited neck flexion, bent spine, contractures of the Achilles tendon, respiratory problems, and cardiomyopathy. Patients may show muscle hypertrophy in the early stages of the disorder. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In XMPMA.
Any additional useful information about the variant.



Sequence information

Variant position:  224
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  323
The length of the canonical sequence.

Location on the sequence:   EDQYYCVDCYKNFVAKKCAG  C KNPITGKRTVSRVSHPVSKA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         EDQYYCVDCYKNFVAKKCA-------------------------------GCKNPITGKRTVSRVSHPVSKA

Mouse                         EDQYYCVDCYKNFVAKKCA----------------------

Rat                           EDQYYCVDCYKNFVAKKCA----------------------

Baker's yeast                 INQVTQAAKNKGITGNPLTALMDKNPQHLNLILAAAVNAAT

Fission yeast                 EQAVQAISLLQQHINKQLGPAAANNPEQATAIANALAVALA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 323 Four and a half LIM domains protein 1
Alternative sequence 168 – 296 Missing. In isoform 3.


Literature citations

An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1.
Windpassinger C.; Schoser B.; Straub V.; Hochmeister S.; Noor A.; Lohberger B.; Farra N.; Petek E.; Schwarzbraun T.; Ofner L.; Loescher W.N.; Wagner K.; Lochmueller H.; Vincent J.B.; Quasthoff S.;
Am. J. Hum. Genet. 82:88-99(2008)
Cited for: VARIANTS XMPMA ILE-128 INS AND TRP-224;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.