UniProtKB/Swiss-Prot P35498: Variant p.Arg1636Gln

Sodium channel protein type 1 subunit alpha
Gene: SCN1A
Feedback?

Variant information Variant position:

1636 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Glutamine (Q) at position 1636 (R1636Q, p.Arg1636Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in a patient with Lennon-Gastaut syndrome; likely pathogenic. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs121917995 [ dbSNP | Ensembl ]

Sequence information Variant position:

1636 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2009 The length of the canonical sequence.
Location on the sequence:

IVGMFLAELIEKYFVSPTLF R VIRLARIGRILRLIKGAKGI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGI

Mouse                         IVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGI

Rat                           IVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2009	Sodium channel protein type 1 subunit alpha
Transmembrane	1634 – 1650	Helical; Name=S4 of repeat IV
Repeat	1523 – 1821	IV
Region	1619 – 1636	S3b-S4 loop of repeat IV
Helix	1632 – 1638

Literature citations
The spectrum of SCN1A-related infantile epileptic encephalopathies.
Harkin L.A.; McMahon J.M.; Iona X.; Dibbens L.; Pelekanos J.T.; Zuberi S.M.; Sadleir L.G.; Andermann E.; Gill D.; Farrell K.; Connolly M.; Stanley T.; Harbord M.; Andermann F.; Wang J.; Batish S.D.; Jones J.G.; Seltzer W.K.; Gardner A.; Sutherland G.; Berkovic S.F.; Mulley J.C.; Scheffer I.E.;
Brain 130:843-852(2007)
Cited for: VARIANTS CYS-393; PRO-395; GLU-422; GLY-626; VAL-1480; SER-1543; GLN-1636 AND HIS-1657; VARIANTS DRVT HIS-79; CYS-84; TRP-101; ARG-199; THR-239; LEU-403; ASN-413; GLY-674; PRO-783; GLU-944; LEU-945; GLU-950; ASP-1238; MET-1390; GLY-1396; PRO-1441; VAL-1545; CYS-1596; GLN-1645; VAL-1707; ARG-1721 AND THR-1922; VARIANT GEFSP2 VAL-973; VARIANT DEE6B MET-226; De novo SCN1A mutations in Dravet syndrome and related epileptic encephalopathies are largely of paternal origin.
Heron S.E.; Scheffer I.E.; Iona X.; Zuberi S.M.; Birch R.; McMahon J.M.; Bruce C.M.; Berkovic S.F.; Mulley J.C.;
J. Med. Genet. 47:137-141(2010)
Cited for: VARIANTS DRVT CYS-84; GLN-101; LYS-171; THR-175; ASN-194; SER-227; PHE-406; ASN-413; PRO-783; GLU-944; LEU-945; HIS-946; GLU-950; GLY-1396; LYS-1450; VAL-1545; GLN-1645; ARG-1726 AND THR-1783; VARIANTS HIS-604; GLN-1636 AND HIS-1657;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.