To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot Q13936: Variant p.Gly490Arg

Voltage-dependent L-type calcium channel subunit alpha-1C
Gene: CACNA1C
Chromosomal location: 12p13.3
Variant information

Variant position:  490
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glycine (G) to Arginine (R) at position 490 (G490R, p.Gly490Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Brugada syndrome 3 (BRGDA3) [MIM:611875]: A heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs, the individual will faint and may die in a few minutes if the heart is not reset. {ECO:0000269|PubMed:17224476}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In BRGDA3; loss of function.
Any additional useful information about the variant.



Sequence information

Variant position:  490
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2221
The length of the canonical sequence.

Location on the sequence:   ETESVNTENVAGGDIEGENC  G ARLAHRISKSKFSRYWRRWN
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN

Mouse                         ETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN

Rat                           ETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN

Rabbit                        ETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2221 Voltage-dependent L-type calcium channel subunit alpha-1C
Topological domain 406 – 524 Cytoplasmic
Modified residue 476 – 476 Phosphothreonine


Literature citations

Loss-of-function mutations in the cardiac calcium channel underlie a new clinical entity characterized by ST-segment elevation, short QT intervals, and sudden cardiac death.
Antzelevitch C.; Pollevick G.D.; Cordeiro J.M.; Casis O.; Sanguinetti M.C.; Aizawa Y.; Guerchicoff A.; Pfeiffer R.; Oliva A.; Wollnik B.; Gelber P.; Bonaros E.P. Jr.; Burashnikov E.; Wu Y.; Sargent J.D.; Schickel S.; Oberheiden R.; Bhatia A.; Hsu L.F.; Haissaguerre M.; Schimpf R.; Borggrefe M.; Wolpert C.;
Circulation 115:442-449(2007)
Cited for: VARIANTS BRGDA3 VAL-39 AND ARG-490; CHARACTERIZATION OF VARIANTS BRGDA3 VAL-39 AND ARG-490;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.