Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q92736: Variant p.Ile4848Val

Ryanodine receptor 2
Gene: RYR2
Feedback?
Variant information Variant position: help 4848 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Isoleucine (I) to Valine (V) at position 4848 (I4848V, p.Ile4848Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CPVT1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 4848 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 4967 The length of the canonical sequence.
Location on the sequence: help GDEIEDPAGDEYEIYRIIFD I TFFFFVIVILLAIIQGLIID The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID

Mouse                         GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID

Rat                           GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID

Rabbit                        GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIID

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 4967 Ryanodine receptor 2
Mutagenesis 4855 – 4855 I -> M. Decreased function in release of sequestered calcium ion into cytosol by sarcoplasmic reticulum. Changed ryanodine-sensitive calcium-release channel activity. Mutant channels are less respositive to activation by caffeine and store calcium overload. Affects channel sensitivity to cytosolic and luminal calcium activation.
Helix 4840 – 4850



Literature citations
Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes.
Choi G.; Kopplin L.J.; Tester D.J.; Will M.L.; Haglund C.M.; Ackerman M.J.;
Circulation 110:2119-2124(2004)
Cited for: VARIANTS CPVT1 SER-164; LEU-414; PHE-419; THR-2403; CYS-4499; THR-4510; ARG-4671 AND VAL-4848;
Spectrum and prevalence of cardiac ryanodine receptor (RyR2) mutations in a cohort of unrelated patients referred explicitly for long QT syndrome genetic testing.
Tester D.J.; Kopplin L.J.; Will M.L.; Ackerman M.J.;
Heart Rhythm 2:1099-1105(2005)
Cited for: VARIANTS CPVT1 GLN-176; LEU-414; PHE-419; ALA-466; THR-2403; PHE-3800; THR-4124; CYS-4499; THR-4510; THR-4556; VAL-4848 AND GLN-4959;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.