UniProtKB/Swiss-Prot Q13642: Variant p.His123Tyr

Four and a half LIM domains protein 1
Gene: FHL1
Chromosomal location: Xq27.2
Variant information

Variant position:  123
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Histidine (H) to Tyrosine (Y) at position 123 (H123Y, p.His123Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and aromatic (Y)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Myopathy, reducing body, X-linked, early-onset, severe (RBM) [MIM:300717]: A rare myopathy clinically characterized by rapidly progressive muscular weakness, and pathologically by the presence of intracytoplasmic inclusion bodies strongly stained by menadione-linked alpha-glycerophosphate dehydrogenase in the absence of substrate, alpha-glycerophosphate. The term 'reducing body' refers to the reducing activity of the inclusions to nitroblue tetrazolium in the absence of substrate. This condition is also commonly associated with rimmed vacuoles and cytoplasmic bodies. Death in childhood is frequent in the severe form of the disease, due to respiratory failure. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In RBM; X-linked severe early-onset; the mutant protein initiates aggregation of the FHL1 protein, forms reducing bodies and traps wild-type FHL1 into the inclusion bodies; consistent with a dominant-negative effect.
Any additional useful information about the variant.



Sequence information

Variant position:  123
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  323
The length of the canonical sequence.

Location on the sequence:   GCFKAIVAGDQNVEYKGTVW  H KDCFTCSNCKQVIGTGSFFP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GCFKA-----------IVAGDQNV----EYKGTVWHKDCFTCSNCKQVI----------GTGSFFP

Mouse                         GCFKA-----------IVAGDQNV----EYKGTVWHKDCFT

Rat                           GCFKA-----------IVAGDQNV----EYKGTIWHKDCFT

Baker's yeast                 TCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRH

Fission yeast                 RTLIA-NPNKKMTLGDICEWIANNWSYYRHQPPAWHNSIRH

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 323 Four and a half LIM domains protein 1
Domain 101 – 153 LIM zinc-binding 2
Beta strand 121 – 123


Literature citations

Proteomic identification of FHL1 as the protein mutated in human reducing body myopathy.
Schessl J.; Zou Y.; McGrath M.J.; Cowling B.S.; Maiti B.; Chin S.S.; Sewry C.; Battini R.; Hu Y.; Cottle D.L.; Rosenblatt M.; Spruce L.; Ganguly A.; Kirschner J.; Judkins A.R.; Golden J.A.; Goebel H.-H.; Muntoni F.; Flanigan K.M.; Mitchell C.A.; Boennemann C.G.;
J. Clin. Invest. 118:904-912(2008)
Cited for: VARIANTS RBM TYR-123; PHE-132; TYR-153 AND ARG-153;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.