To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot Q99836: Variant p.Leu93Pro

Myeloid differentiation primary response protein MyD88
Gene: MYD88
Chromosomal location: 3p22
Variant information

Variant position:  93
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Proline (P) at position 93 (L93P, p.Leu93Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  MYD88 deficiency (MYD88D) [MIM:612260]: Patients suffer from autosomal recessive, life-threatening, often recurrent pyogenic bacterial infections, including invasive pneumococcal disease, and die between 1 and 11 months of age. Surviving patients are otherwise healthy, with normal resistance to other microbes, and their clinical status improved with age. {ECO:0000269|PubMed:18669862, ECO:0000269|PubMed:19506249, ECO:0000269|PubMed:21057262, ECO:0000269|PubMed:24316379}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MYD88D; results in a loss of function; loss of NF-kappa-B complex activation.
Any additional useful information about the variant.



Sequence information

Variant position:  93
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  296
The length of the canonical sequence.

Location on the sequence:   RLLDAWQGRPGASVGRLLEL  L TKLGRDDVLLELGPSIEEDC
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RLLDAWQGRP--GASVGRLLELLTKLGRDDVLLELGPSIEEDC

Gorilla                       RLLDAWQGRP--GASVGRLLELLTKLGRDDVLLELGPSIEE

Rhesus macaque                RLLDAWQGRP--GASVGRLLELLTKLGRDDVLLELGPSIEE

Chimpanzee                    RLLDAWQGRP--GASVGRLLELLTKLGRDDVLLELGPSIEE

Mouse                         SLLDAWQGRS--GASVGRLLELLALLDREDILKELKSRIEE

Rat                           SLLDAWQGRS--GSSVGRLLELLALLDREDILYELKDRIEE

Pig                           SLLDDWQGRP--GASVGRLLELLAKLGRDDVLVELGPSIEE

Bovine                        RLLDDWQRRP--GASVGRLLELLAKLGRDDVLMELGPSIEE

Sheep                         RLLDDWQRRP--GASVGRLLELLAKLGREDVLMELGPSIEE

Chicken                       ALLEEWQSRCPGGATVGQLLELLRQLGRHDVLLELGGSVEE

Xenopus tropicalis            KLLEDWEKKCF-RATVGGLLEMLKKMERNDILTDLGPLIEA

Zebrafish                     KVLTDWETRP--DATVANLLSILEKAERKDVISELKEILDD

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 296 Myeloid differentiation primary response protein MyD88
Domain 54 – 109 Death
Alternative sequence 110 – 110 E -> G. In isoform 4.
Helix 86 – 96


Literature citations

Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.
Yamamoto T.; Tsutsumi N.; Tochio H.; Ohnishi H.; Kubota K.; Kato Z.; Shirakawa M.; Kondo N.;
Mol. Immunol. 58:66-76(2014)
Cited for: FUNCTION; INTERACTION WITH IRAK4; CHARACTERIZATION OF VARIANTS TYR-34; CYS-98 AND ILE-178; CHARACTERIZATION OF VARIANTS MYD88D GLU-52 DEL; PRO-93 AND CYS-196;

Pyogenic bacterial infections in humans with MyD88 deficiency.
von Bernuth H.; Picard C.; Jin Z.; Pankla R.; Xiao H.; Ku C.-L.; Chrabieh M.; Mustapha I.B.; Ghandil P.; Camcioglu Y.; Vasconcelos J.; Sirvent N.; Guedes M.; Vitor A.B.; Herrero-Mata M.J.; Arostegui J.I.; Rodrigo C.; Alsina L.; Ruiz-Ortiz E.; Juan M.; Fortuny C.; Yaguee J.; Anton J.; Pascal M.; Chang H.-H.; Janniere L.; Rose Y.; Garty B.-Z.; Chapel H.; Issekutz A.; Marodi L.; Rodriguez-Gallego C.; Banchereau J.; Abel L.; Li X.; Chaussabel D.; Puel A.; Casanova J.-L.;
Science 321:691-696(2008)
Cited for: VARIANTS MYD88D PRO-93 AND CYS-196; CHARACTERIZATION OF VARIANTS MYD88D PRO-93 AND CYS-196;

Clinical features and outcome of patients with IRAK-4 and MyD88 deficiency.
Picard C.; von Bernuth H.; Ghandil P.; Chrabieh M.; Levy O.; Arkwright P.D.; McDonald D.; Geha R.S.; Takada H.; Krause J.C.; Creech C.B.; Ku C.L.; Ehl S.; Marodi L.; Al-Muhsen S.; Al-Hajjar S.; Al-Ghonaium A.; Day-Good N.K.; Holland S.M.; Gallin J.I.; Chapel H.; Speert D.P.; Rodriguez-Gallego C.; Colino E.; Garty B.Z.; Roifman C.; Hara T.; Yoshikawa H.; Nonoyama S.; Domachowske J.; Issekutz A.C.; Tang M.; Smart J.; Zitnik S.E.; Hoarau C.; Kumararatne D.S.; Thrasher A.J.; Davies E.G.; Bethune C.; Sirvent N.; de Ricaud D.; Camcioglu Y.; Vasconcelos J.; Guedes M.; Vitor A.B.; Rodrigo C.; Almazan F.; Mendez M.; Arostegui J.I.; Alsina L.; Fortuny C.; Reichenbach J.; Verbsky J.W.; Bossuyt X.; Doffinger R.; Abel L.; Puel A.; Casanova J.L.;
Medicine (Baltimore) 89:403-425(2010)
Cited for: INVOLVEMENT IN MYD88D; VARIANTS MYD88D GLU-52 DEL; PRO-93 AND CYS-196;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.