UniProtKB/Swiss-Prot Q9H3G5: Variant p.Arg25His

Probable serine carboxypeptidase CPVL
Gene: CPVL
Feedback?

Variant information Variant position:

25 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Histidine (H) at position 25 (R25H, p.Arg25His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs34219043 [ dbSNP | Ensembl ]

Sequence information Variant position:

25 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

476 The length of the canonical sequence.
Location on the sequence:

MWKVIVSLVLLMPGPCDGLF R SLYRSVSMPPKGDSGQPLFL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MWKVIVSLVLLMPGPCDGLFRSLYRS--VSMPPK-------------GDSGQPLFL

Mouse                         KWKMVVSLILFMVSPGDGLFHAVYRSILVSQSFK-------

Rat                           QWKVIILLILLMVIPSDGLFHSIYRSILVAQPFK-------

Slime mold                    SLSFLLTILIVIITIKVNLSQEIKISPFFANNLKFEPIPDY

Literature citations
Cloning of VCP-like protein expressed in human heart and placenta.
Cho J.-J.; Baik H.-H.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS HIS-25 AND HIS-398;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.