UniProtKB/Swiss-Prot P41180: Variant p.Cys131Trp

Extracellular calcium-sensing receptor
Gene: CASR
Chromosomal location: 3q21-q24
Variant information

Variant position:  131
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Cysteine (C) to Tryptophan (W) at position 131 (C131W, p.Cys131Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Hypocalcemia, autosomal dominant 1 (HYPOC1) [MIM:601198]: A disorder of mineral homeostasis characterized by blood calcium levels below normal, and low or normal serum parathyroid hormone concentrations. Disease manifestations include mild or asymptomatic hypocalcemia, paresthesias, carpopedal spasm, seizures, hypercalciuria with nephrocalcinosis or kidney stones, and ectopic and basal ganglia calcifications. Few patients manifest hypocalcemia and features of Bartter syndrome, including hypomagnesemia, hypokalemia, metabolic alkalosis, hyperreninemia, and hyperaldosteronemia. {ECO:0000269|PubMed:10487661, ECO:0000269|PubMed:12050233, ECO:0000269|PubMed:12107202, ECO:0000269|PubMed:12241879, ECO:0000269|PubMed:12574188, ECO:0000269|PubMed:12915654, ECO:0000269|PubMed:15551332, ECO:0000269|PubMed:16608894, ECO:0000269|PubMed:19179454, ECO:0000269|PubMed:22789683, ECO:0000269|PubMed:23169696, ECO:0000269|PubMed:23966241, ECO:0000269|PubMed:25766501, ECO:0000269|PubMed:7874174, ECO:0000269|PubMed:8702647, ECO:0000269|PubMed:8733126, ECO:0000269|PubMed:8813042, ECO:0000269|PubMed:8878438, ECO:0000269|PubMed:9253358, ECO:0000269|PubMed:9661634, ECO:0000269|PubMed:9920108}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In HYPOC1; associated with clinical features of Bartter syndrome.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  131
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1078
The length of the canonical sequence.

Location on the sequence:   TLSFVAQNKIDSLNLDEFCN  C SEHIPSTIAVVGATGSGVST
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVST

Mouse                         TLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVST

Rat                           TLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVST

Pig                           TLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGIST

Bovine                        TLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGIST

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 20 – 1078 Extracellular calcium-sensing receptor
Topological domain 20 – 612 Extracellular
Region 22 – 188 Ligand-binding 1 (LB1)
Metal binding 145 – 145 Calcium
Binding site 147 – 147 Aromatic amino acid
Glycosylation 130 – 130 N-linked (GlcNAc...) asparagine
Disulfide bond 129 – 129 Interchain
Disulfide bond 131 – 131 Interchain
Mutagenesis 145 – 145 T -> A. Abolishes G-protein coupled receptor activity.
Mutagenesis 147 – 147 S -> A. Nearly abolished G-protein coupled receptor activity.


Literature citations

Association between activating mutations of calcium-sensing receptor and Bartter's syndrome.
Watanabe S.; Fukumoto S.; Chang H.; Takeuchi Y.; Hasegawa Y.; Okazaki R.; Chikatsu N.; Fujita T.;
Lancet 360:692-694(2002)
Cited for: VARIANTS HYPOC1 TRP-131 AND GLU-843;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.